DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Asator and CLK1

DIOPT Version :9

Sequence 1:NP_651924.2 Gene:Asator / 43794 FlyBaseID:FBgn0039908 Length:1349 Species:Drosophila melanogaster
Sequence 2:NP_001155879.1 Gene:CLK1 / 1195 HGNCID:2068 Length:526 Species:Homo sapiens


Alignment Length:443 Identity:92/443 - (20%)
Similarity:157/443 - (35%) Gaps:124/443 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 SSNLPAQDSY--SHQPRNQVAVAAKDGILVDVKAKESVKMTSED--LLQPGHVVKERWKVVRKIG 180
            ||....:.||  .|:..:..:.....|.....|...||:...|.  :.|.|.|:..|:::|..:|
Human   146 SSGRSGRSSYKSKHRIHHSTSHRRSHGKSHRRKRTRSVEDDEEGHLICQSGDVLSARYEIVDTLG 210

  Fly   181 GGGFGEIYEGQD-LITREQVALKV--------ESARQPKQVLK-----------MEVAVLKKLQG 225
            .|.||::.|..| ......||:|:        |:||...|||:           ..|.:|:..:.
Human   211 EGAFGKVVECIDHKAGGRHVAVKIVKNVDRYCEAARSEIQVLEHLNTTDPNSTFRCVQMLEWFEH 275

  Fly   226 KEHVCRFIGCGRNDRFNYVVMQLQGKNLAELRRAQPRGAFSLSTTLRLGLQILKAIESIHSVGFL 290
            ..|:|             :|.:|.|.:..:..:......|.|....::..||.|::..:||....
Human   276 HGHIC-------------IVFELLGLSTYDFIKENGFLPFRLDHIRKMAYQICKSVNFLHSNKLT 327

  Fly   291 HRDIKPSNFSVGRLPY------NCRR---------VYMLDFGLA----RQYTT--GTGEVRCPRA 334
            |.|:||.|....:..|      ..:|         :.::|||.|    ..::|  .|...|.|..
Human   328 HTDLKPENILFVQSDYTEAYNPKIKRDERTLINPDIKVVDFGSATYDDEHHSTLVSTRHYRAPEV 392

  Fly   335 --AAGFRGTVRYASINAHRNREMGRHDDLWSLFYMLVEFVNGQLPWRKIKDKEQVGLTKEKYDHR 397
              |.|:                 .:..|:||:..:|:|:..|...:.....||.:.:.:     |
Human   393 ILALGW-----------------SQPCDVWSIGCILIEYYLGFTVFPTHDSKEHLAMME-----R 435

  Fly   398 ILLKHLPSDLKQFLEHIQSLTYGDRPDYAMLIGLFERCMKRRGVKESDPYDWEKVDSTAIGNISA 462
            ||                    |..|.:     :.::..||: ....|..||:: .|:|...:|.
Human   436 IL--------------------GPLPKH-----MIQKTRKRK-YFHHDRLDWDE-HSSAGRYVSR 473

  Fly   463 TGNP--SIPIKSDYMHGNITQMTVAASNASGTEYIRKRAEIETA-HITATDPL 512
            ...|  ...:..|..|..:..:            |:|..|.:.| .||..:.|
Human   474 RCKPLKEFMLSQDVEHERLFDL------------IQKMLEYDPAKRITLREAL 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsatorNP_651924.2 STKc_TTBK 172..433 CDD:270919 61/303 (20%)
S_TKc 173..414 CDD:214567 58/283 (20%)
CLK1NP_001155879.1 PKc_CLK1_4 190..519 CDD:271115 82/399 (21%)
S_TKc 203..519 CDD:214567 78/386 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.