DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Asator and csnk1e

DIOPT Version :9

Sequence 1:NP_651924.2 Gene:Asator / 43794 FlyBaseID:FBgn0039908 Length:1349 Species:Drosophila melanogaster
Sequence 2:NP_997912.1 Gene:csnk1e / 100006858 ZFINID:ZDB-GENE-030131-7873 Length:417 Species:Danio rerio


Alignment Length:292 Identity:107/292 - (36%)
Similarity:153/292 - (52%) Gaps:17/292 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 VKERWKVVRKIGGGGFGEIYEGQDLITREQVALKVESARQPKQVLKMEVAVLKKLQGKEHVCRFI 233
            |..::::.||||.|.||:||.|.::.:.|:||:|:||.:.....|.:|....|.:||...:....
Zfish     5 VGSKYRLGRKIGSGSFGDIYLGANITSGEEVAIKLESVKTKHPQLHIESKFYKMMQGGVGIPSIK 69

  Fly   234 GCGRNDRFNYVVMQLQGKNLAELRRAQPRGAFSLSTTLRLGLQILKAIESIHSVGFLHRDIKPSN 298
            .||....:|.:||:|.|.:|.:|.....| .|:|.|.|.|..|::..||.|||..|:||||||.|
Zfish    70 WCGAEGDYNVMVMELLGPSLEDLFNFCSR-KFTLKTVLLLADQMISRIEYIHSKNFIHRDIKPDN 133

  Fly   299 FSVGRLPYNCRRVYMLDFGLARQYTTGTGEVRCP-RAAAGFRGTVRYASINAHRNREMGRHDDLW 362
            |.:| |......||::|||||::|.........| |......||.||||||.|...|..|.|||.
Zfish   134 FLMG-LGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLE 197

  Fly   363 SLFYMLVEFVNGQLPWRKIKDKEQVGLTKEKYDH----------RILLKHLPSDLKQFLEHIQSL 417
            ||.|:|:.|..|.|||:.:|    ....::||:.          .:|.|..||:...::...:||
Zfish   198 SLGYVLMYFNLGSLPWQGLK----AATKRQKYERISEKKMSTPIEVLCKGFPSEFSTYMNFCRSL 258

  Fly   418 TYGDRPDYAMLIGLFERCMKRRGVKESDPYDW 449
            .:.|:|||:.|..||.....|:|......:||
Zfish   259 RFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDW 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AsatorNP_651924.2 STKc_TTBK 172..433 CDD:270919 101/271 (37%)
S_TKc 173..414 CDD:214567 93/251 (37%)
csnk1eNP_997912.1 SPS1 8..360 CDD:223589 106/289 (37%)
STKc_CK1_delta_epsilon 8..282 CDD:271027 103/279 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.