DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bip2 and PHO23

DIOPT Version :9

Sequence 1:NP_651923.2 Gene:bip2 / 43793 FlyBaseID:FBgn0026262 Length:1406 Species:Drosophila melanogaster
Sequence 2:NP_014302.3 Gene:PHO23 / 855626 SGDID:S000005041 Length:330 Species:Saccharomyces cerevisiae


Alignment Length:340 Identity:77/340 - (22%)
Similarity:136/340 - (40%) Gaps:92/340 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly  1090 DKRQKKEKKKD--KDKQILVHIPDDTEEFDKVPLANNDEPVLKSSSMTINPSLGAATS------- 1145
            ::|..|..|||  ||.|..|.:.::..:..:..:.:.:|.:..||.|..|  |...||       
Yeast    47 NERIDKFLKKDFNKDHQTQVRLLNNINKIYEELMPSLEEKMHVSSIMLDN--LDRLTSRLELAYE 109

  Fly  1146 -GISPNQIPK-LTLKLSGKSTLFSSSE--KEMTDAGKLKQTTILSSENKK--------------- 1191
             .|...:||: |.|.:.....:....|  :::......|.:..|.||:::               
Yeast   110 VAIKNTEIPRGLRLGVDNHPAMHLHHELMEKIESKSNSKSSQALKSESRREAMAANRRQGEHYSA 174

  Fly  1192 --RERDNSPELARFSPLVTGPPKNKQSETLHLGNSSTAVLPVPSPVAVRAVQLPVSQTSSNSAGW 1254
              .::|:|...|.:     |..:::..:  |.||::.                  |:..:|:|  
Yeast   175 STHQQDDSKNDANY-----GGSRHESQD--HTGNNTN------------------SRKRANAA-- 212

  Fly  1255 LSNPNNSNTASSTLS---ASSVLLPQQLMLAPHTIMNNFVPAMCNSTGTVSKSGLCSSPPNTSEE 1316
              |.||::..:....   |::.:.|..:..|  |.:||      ...||.:.|...||..|::. 
Yeast   213 --NTNNADPETKKRKRRVATTAVSPSTISTA--TAVNN------GRIGTSTASRGVSSVGNSNN- 266

  Fly  1317 NANAMQIAESSRPSSYVDAEGNRIWICPACGKVDDGSAMIGCDGCDA---WYHWICVGITFAPKD 1378
                   :..|||.:  :..|..:: | .|.:|..|. |:||||.|.   |:|..|:|:...||.
Yeast   267 -------SRISRPKT--NDYGEPLY-C-YCNQVAYGE-MVGCDGADCELEWFHLPCIGLETLPKG 319

  Fly  1379 NDDWFCRVCVTKKRI 1393
            .  |:|..|  ||::
Yeast   320 K--WYCDDC--KKKL 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bip2NP_651923.2 BTP 4..80 CDD:128846
PHD_TAF3 1342..1387 CDD:276997 18/47 (38%)
PHO23NP_014302.3 TNG2 5..330 CDD:227367 77/338 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.