DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bip2 and ING5

DIOPT Version :9

Sequence 1:NP_651923.2 Gene:bip2 / 43793 FlyBaseID:FBgn0026262 Length:1406 Species:Drosophila melanogaster
Sequence 2:XP_016860586.1 Gene:ING5 / 84289 HGNCID:19421 Length:300 Species:Homo sapiens


Alignment Length:117 Identity:39/117 - (33%)
Similarity:49/117 - (41%) Gaps:24/117 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly  1299 GTVSKSGLCSSPPNTSEENA-------NAMQIAE---SSRPSSYVD--AEGNRIWICPACGKVDD 1351
            |...|.|.......||||:.       ...:..:   |..||..:|  .:.|....| .|.:|..
Human   193 GQKEKRGSRGRGRRTSEEDTPKKKKHKGGSEFTDTILSVHPSDVLDMPVDPNEPTYC-LCHQVSY 256

  Fly  1352 GSAMIGCDGCDA---WYHWICVGITFAPKDNDDWFCRVCVTKKRIHGSEKKK 1400
            |. |||||..|.   |:|:.||.:|..||..  |||..||.:||     |||
Human   257 GE-MIGCDNPDCPIEWFHFACVDLTTKPKGK--WFCPRCVQEKR-----KKK 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bip2NP_651923.2 BTP 4..80 CDD:128846
PHD_TAF3 1342..1387 CDD:276997 20/47 (43%)
ING5XP_016860586.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.