DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bip2 and ing5a

DIOPT Version :9

Sequence 1:NP_651923.2 Gene:bip2 / 43793 FlyBaseID:FBgn0026262 Length:1406 Species:Drosophila melanogaster
Sequence 2:NP_001093519.1 Gene:ing5a / 792168 ZFINID:ZDB-GENE-031016-1 Length:242 Species:Danio rerio


Alignment Length:392 Identity:75/392 - (19%)
Similarity:110/392 - (28%) Gaps:197/392 - (50%)


- Green bases have known domain annotations that are detailed below.


  Fly  1013 KISEEHNIFSTFSNYEDITITPTGLTSLEPKMRKHHKKLKKVKEGKNKKKKEKKDKSKKADQIGL 1077
            |::||:     .:|          :.:|.|..|..|  |:|::.|.:|.|:...||.:.|.|...
Zfish    44 KLAEEY-----IAN----------VRNLAPDQRVEH--LQKIQNGFSKCKEYSDDKVQLAMQTYE 91

  Fly  1078 PSFKSDRKIKANDKRQKKEKKKDKDKQILVHIPDDTEEFDKVPLANNDEPVLKSSSMTINPSLGA 1142
            ...|..|::.|:..|.:.|.|:..|                                        
Zfish    92 MVDKHIRRLDADLARFENELKEKLD---------------------------------------- 116

  Fly  1143 ATSGISPNQIPKLTLKLSGKSTLFSSSEKEMTDAGKLKQTTILSSENKKRERDNSPELARFSPLV 1207
                            :||..:..:.:.|::|..|.||:........:|...|.||.        
Zfish   117 ----------------VSGYESPDNRTHKKVTGRGNLKEKRRPKGRGRKSSDDESPR-------- 157

  Fly  1208 TGPPKNKQSETLHLGNSSTAVLPV-PSPVAVRAVQLPVSQTSSNSAGWLSNPNNSNTASSTLSAS 1271
                |.|...:.....|   :||| ||.|    :.:||            :||.           
Zfish   158 ----KKKMKNSPEFPES---ILPVHPSDV----LDMPV------------DPNE----------- 188

  Fly  1272 SVLLPQQLMLAPHTIMNNFVPAMCNSTGTVSKSGLCSSPPNTSEENANAMQIAESSRPSSYVDAE 1336
                                |..|                                         
Zfish   189 --------------------PTYC----------------------------------------- 192

  Fly  1337 GNRIWICPACGKVDDGSAMIGCDGCDA---WYHWICVGITFAPKDNDDWFCRVCVTKKRIHGSEK 1398
                    .|.:|..|. |||||..|.   |:|:.||.:|..||..  |||..| |:.|     |
Zfish   193 --------LCHQVSYGE-MIGCDNPDCPIEWFHFACVDLTTKPKGK--WFCPRC-TQDR-----K 240

  Fly  1399 KK 1400
            ||
Zfish   241 KK 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bip2NP_651923.2 BTP 4..80 CDD:128846
PHD_TAF3 1342..1387 CDD:276997 19/47 (40%)
ing5aNP_001093519.1 TNG2 1..235 CDD:227367 69/377 (18%)
ING 6..105 CDD:289749 20/77 (26%)
PHD_ING5 190..238 CDD:277155 22/100 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.