DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bip2 and Ing2

DIOPT Version :9

Sequence 1:NP_651923.2 Gene:bip2 / 43793 FlyBaseID:FBgn0026262 Length:1406 Species:Drosophila melanogaster
Sequence 2:NP_075992.2 Gene:Ing2 / 69260 MGIID:1916510 Length:281 Species:Mus musculus


Alignment Length:234 Identity:57/234 - (24%)
Similarity:97/234 - (41%) Gaps:42/234 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  1190 KKRERDNSPELARFSPLVTGPPKNKQSETLHLGNSS----TAVLPVPSPVAVRAVQLPV-SQTSS 1249
            |.::.|:|.:..|....:.....|.|    .||:..    |.:|.:   |..||.|:.: ||.  
Mouse    70 KYKKEDDSNQKKRLQQHLQRALINSQ----ELGDEKIQIVTQMLEL---VENRARQMELHSQC-- 125

  Fly  1250 NSAGWLSNPNNSNTAS--STLSASSVLLPQQLMLAPHTIMNNFVPAMCNSTGTVSKSGLCSSPPN 1312
                 ..:|..|..||  |.:.:|.   |::....|.....:....:|:.|..:..   |...|.
Mouse   126 -----FQDPAESERASDKSKMDSSQ---PERSSRRPRRQRTSESRDLCHMTNGIDD---CDDQPP 179

  Fly  1313 TSEENANAMQ----IAESSRPSSYVD--AEGNRIWICPACGKVDDGSAMIGCDG--CD-AWYHWI 1368
            ..:.:.:|.:    .|:..|.:|.|:  .:.|....| .|.:|..|. |||||.  |. .|:|:.
Mouse   180 KEKRSKSAKKKKRSKAKQEREASPVEFAIDPNEPTYC-LCNQVSYGE-MIGCDNEQCPIEWFHFS 242

  Fly  1369 CVGITFAPKDNDDWFCRVC--VTKKRIHGSEKKKRRNKK 1405
            ||.:|:.||..  |:|..|  ..:|.:..|.:|.::.::
Mouse   243 CVSLTYKPKGK--WYCPKCRGDNEKTMDKSTEKTKKERR 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bip2NP_651923.2 BTP 4..80 CDD:128846
PHD_TAF3 1342..1387 CDD:276997 19/47 (40%)
Ing2NP_075992.2 ING 28..122 CDD:289749 14/58 (24%)
TNG2 31..260 CDD:227367 53/213 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 123..204 18/93 (19%)
PHD_ING2 214..262 CDD:277153 20/51 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 261..281 3/19 (16%)
PBR. /evidence=ECO:0000250|UniProtKB:Q9H160 265..281 3/15 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.