DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bip2 and Taf8

DIOPT Version :9

Sequence 1:NP_651923.2 Gene:bip2 / 43793 FlyBaseID:FBgn0026262 Length:1406 Species:Drosophila melanogaster
Sequence 2:XP_036016625.1 Gene:Taf8 / 63856 MGIID:1926879 Length:322 Species:Mus musculus


Alignment Length:195 Identity:43/195 - (22%)
Similarity:75/195 - (38%) Gaps:37/195 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VVVAQITQTIGYSCTLSAPLELLQDILQKFVQEFARDMHRHMEHANRIEPNLKDARLSIKNLSIN 77
            |||:.:....|:.....|.:|.|.::||.::.|..|....:.||..|.:|.|.|..:::..:..|
Mouse    37 VVVSSLLTEAGFESAEKASVETLTEMLQSYISEIGRSAKSYCEHTARTQPTLSDIVVTLVEMGFN 101

  Fly    78 VQELLDY-------IGNVEPVGFIRDVPQFPIGKSVNMNFLKPGSAETLTRPVYIFEYLPPMQDP 135
            |..|..|       :....||   .:.|..|...:...|  :|       .|.:|..:.|...||
Mouse   102 VDTLPAYAKRSQRMVITAPPV---TNQPVTPKALTAGQN--RP-------HPPHIPSHFPEFPDP 154

  Fly   136 E-------LREIPADVQ----KEFSEKQE-------FCSKAEYSSTNAADKLGAKHIDSISPNTV 182
            .       .||..:|.|    |..|::::       |.:|...:.:...|.:....:.:..|.|:
Mouse   155 HTYIKTPTYREPVSDYQILREKAASQRRDVERALTRFMAKTGETQSLFKDDVSTFPLIAARPFTI 219

  Fly   183  182
            Mouse   220  219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bip2NP_651923.2 BTP 4..80 CDD:128846 19/66 (29%)
PHD_TAF3 1342..1387 CDD:276997
Taf8XP_036016625.1 Bromo_TP 27..104 CDD:400073 19/66 (29%)
TAF8 142..195 CDD:176263 11/52 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2389
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1475
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.