Sequence 1: | NP_651923.2 | Gene: | bip2 / 43793 | FlyBaseID: | FBgn0026262 | Length: | 1406 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_036016625.1 | Gene: | Taf8 / 63856 | MGIID: | 1926879 | Length: | 322 | Species: | Mus musculus |
Alignment Length: | 195 | Identity: | 43/195 - (22%) |
---|---|---|---|
Similarity: | 75/195 - (38%) | Gaps: | 37/195 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 VVVAQITQTIGYSCTLSAPLELLQDILQKFVQEFARDMHRHMEHANRIEPNLKDARLSIKNLSIN 77
Fly 78 VQELLDY-------IGNVEPVGFIRDVPQFPIGKSVNMNFLKPGSAETLTRPVYIFEYLPPMQDP 135
Fly 136 E-------LREIPADVQ----KEFSEKQE-------FCSKAEYSSTNAADKLGAKHIDSISPNTV 182
Fly 183 182 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
bip2 | NP_651923.2 | BTP | 4..80 | CDD:128846 | 19/66 (29%) |
PHD_TAF3 | 1342..1387 | CDD:276997 | |||
Taf8 | XP_036016625.1 | Bromo_TP | 27..104 | CDD:400073 | 19/66 (29%) |
TAF8 | 142..195 | CDD:176263 | 11/52 (21%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG2389 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R1475 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.840 |