DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bip2 and taf8

DIOPT Version :9

Sequence 1:NP_651923.2 Gene:bip2 / 43793 FlyBaseID:FBgn0026262 Length:1406 Species:Drosophila melanogaster
Sequence 2:XP_012818203.1 Gene:taf8 / 549471 XenbaseID:XB-GENE-491356 Length:293 Species:Xenopus tropicalis


Alignment Length:326 Identity:65/326 - (19%)
Similarity:114/326 - (34%) Gaps:86/326 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VVVAQITQTIGYSCTLSAPLELLQDILQKFVQEFARDMHRHMEHANRIEPNLKDARLSIKNLSIN 77
            |||:.:....|:.....|.:|.|.::||.::.|..|....:.||..|.:|.|.|..:::..:..|
 Frog    29 VVVSSLLTEAGFESAEKAAVESLTEMLQSYLSEIGRSAKSYCEHTARTQPTLPDIVVTLIEMGFN 93

  Fly    78 VQELLDY-------IGNVEPVGFIRDVPQFPIGKSVNMNFLKPGSAETLTRPVYIFEYLPPMQDP 135
            |:.|..|       :....||   .:.|..|...|...|         ...|.:|..:.|...||
 Frog    94 VESLPAYAKRSQRMVITAPPV---TNNPVVPKALSAGQN---------KQHPAHIPSHFPEFPDP 146

  Fly   136 E-------LREIPADVQ----KEFSEKQEFCSKAEYSSTNAADKLGAKHIDSISPNTVINFRSNA 189
            .       .||...|.|    |..|::::    .|.:.|....|.|       ...::....::.
 Frog   147 HTYIKTPTYREPVCDYQVLREKAASQRRD----VERALTRFMAKTG-------ETQSLFKDDTST 200

  Fly   190 FELDVGSSVREMSSVVMTTGGFISPAIEGKLPEDIIPDIVEKFLGLDAPFSPTIIVNSLQKSPQL 254
            |.|   .:.|.:|          .|.:...||.::                      .||:..:.
 Frog   201 FPL---IAARPLS----------IPYLNALLPSEL----------------------ELQQVEET 230

  Fly   255 ALSDRDKTVNPRKII----PSETKIFKQNAALLTSGH---SESSIIYASNNHTMLTVTTPKKNRK 312
            ..|::|...:...:.    ..|..:.|:|:::|....   .|.::|   :|..:..|..||..||
 Frog   231 DSSEQDDQTDAENLSMHLQGDEVGMEKENSSVLQQNSMKGGEETLI---DNPYLRPVKKPKLRRK 292

  Fly   313 Q 313
            :
 Frog   293 K 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bip2NP_651923.2 BTP 4..80 CDD:128846 19/66 (29%)
PHD_TAF3 1342..1387 CDD:276997
taf8XP_012818203.1 Bromo_TP 22..96 CDD:369402 19/66 (29%)
TAF8 134..187 CDD:176263 12/56 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1475
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.