DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bip2 and sa

DIOPT Version :9

Sequence 1:NP_651923.2 Gene:bip2 / 43793 FlyBaseID:FBgn0026262 Length:1406 Species:Drosophila melanogaster
Sequence 2:NP_649311.1 Gene:sa / 40367 FlyBaseID:FBgn0002842 Length:275 Species:Drosophila melanogaster


Alignment Length:274 Identity:47/274 - (17%)
Similarity:99/274 - (36%) Gaps:62/274 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 QITQTIGYSCTLSAPLELLQDILQKFVQEFARDMHRHM--------EHANRIEPNLKDARLSIKN 73
            ::..|:..:...|...|::.|:|::.:.|..|...|.:        .||.|..|:..|...:...
  Fly     6 EVLATVLDNLLASKNCEVVDDVLRQSMLELLRGKFREIARQTTNWSNHAGRCAPSYFDLERTFIR 70

  Fly    74 LSINVQEL-LDYIGNVEPVGFI------------RDVPQFPIGKSVNMNFLKPGSAETLTRPVYI 125
            ::|.|.|| ..|.|..:.:..:            ..||| |:        |....|..|....||
  Fly    71 MNIKVGELKAMYEGQPDSLVLVECNAPETQDQDFHSVPQ-PV--------LSSTKAVELASTTYI 126

  Fly   126 FEYLPPMQDPELREIPADVQKEFSEKQEFC-----SKAEYSSTNAADKL---------------- 169
            .::|||.  |......:...::.:::....     ::.|.::.||.::.                
  Fly   127 PDHLPPF--PGAHTYKSSTIEKVTDRSYVAMRNRHAENELNTQNALNQYYLRCNPNISLFEETQR 189

  Fly   170 -GAKHIDSISPNTVINF------RSNAFELDVGSSVREMSSVVMTTGGFISPAIEGKLPEDIIPD 227
             |:.|:..:.|...:.:      |:..|:.|:.:.:..::...:.......|.:....|..  .:
  Fly   190 DGSGHVLDLGPPKKLPYSDALMPRNQVFDTDIYAPIEVITHKALDCRYLEKPKLHSSRPSS--GN 252

  Fly   228 IVEKFLGLDAPFSP 241
            ..|:.:.::.|.||
  Fly   253 FEEEDVEMEEPCSP 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bip2NP_651923.2 BTP 4..80 CDD:128846 15/70 (21%)
PHD_TAF3 1342..1387 CDD:276997
saNP_649311.1 Bromo_TP 6..77 CDD:284856 15/70 (21%)
TAF8 125..177 CDD:176263 9/53 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2389
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.