DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bip2 and taf8

DIOPT Version :9

Sequence 1:NP_651923.2 Gene:bip2 / 43793 FlyBaseID:FBgn0026262 Length:1406 Species:Drosophila melanogaster
Sequence 2:XP_005162360.1 Gene:taf8 / 393256 ZFINID:ZDB-GENE-040426-1013 Length:308 Species:Danio rerio


Alignment Length:329 Identity:64/329 - (19%)
Similarity:118/329 - (35%) Gaps:89/329 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VVVAQITQTIGYSCTLSAPLELLQDILQKFVQEFARDMHRHMEHANRIEPNLKDARLSIKNLSIN 77
            |||:.:....|:.....|.:|.|.:::|.::.|..|....:.||..|..|.|.|..:::..:..|
Zfish    41 VVVSALLTECGFDSAEKAVVETLTEMMQSYITEVGRCAKANCEHTARSTPTLSDVVITLVEMGFN 105

  Fly    78 VQELLDYIGNVEPVGF----IRDVPQFPIGKSVNMNFLKPGSAETLTRPVYIFEYLPPMQDPE-- 136
            |..|..|....:.:..    |.:.|..|  ||:.       :.:..|.|.:|..:.|...||.  
Zfish   106 VDTLPVYAKRSQRMVITAPPITNAPVVP--KSLT-------AGQKRTHPAHIPSHFPDFPDPHTY 161

  Fly   137 -----LREIPADVQ----KEFSEKQE-------FCSKAEYSSTNAADKLGAKHIDSISPNTVINF 185
                 .||..:|.|    |..|::::       |.:|...:.:...|.:.|..:.:..|:.:   
Zfish   162 IRTPTFREPVSDYQVVREKAASQRRDVERALTRFMAKTGETQSLFKDDISAFPLIAAKPSPI--- 223

  Fly   186 RSNAFELDVGSSVREMSSVVMTTGGFISPAIEGKLPEDIIPDIVEKFLGLDAPFSPTIIVNSLQK 250
                                        |.:...||.::....:|:             .:|.::
Zfish   224 ----------------------------PYLSALLPSELELQSLEE-------------TDSSEQ 247

  Fly   251 SPQLALSDRDKTVNPRKIIPSETKIFKQNAALLTSG------HSESSIIYASNNHTMLTVTTPKK 309
            ..|:   |.|.  |...|:..::...|:|..|...|      .:|.::|   :|..:..|..||.
Zfish   248 DDQM---DNDN--NTSHIMQDDSGADKENEVLPPGGVVPSGKANEENMI---DNPYLRPVKKPKV 304

  Fly   310 NRKQ 313
            .||:
Zfish   305 RRKK 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bip2NP_651923.2 BTP 4..80 CDD:128846 18/66 (27%)
PHD_TAF3 1342..1387 CDD:276997
taf8XP_005162360.1 Bromo_TP 32..108 CDD:284856 18/66 (27%)
TAF8 146..199 CDD:176263 11/52 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2389
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1475
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.