DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bip2 and ing5b

DIOPT Version :9

Sequence 1:NP_651923.2 Gene:bip2 / 43793 FlyBaseID:FBgn0026262 Length:1406 Species:Drosophila melanogaster
Sequence 2:NP_001007169.1 Gene:ing5b / 368450 ZFINID:ZDB-GENE-030616-462 Length:239 Species:Danio rerio


Alignment Length:341 Identity:71/341 - (20%)
Similarity:106/341 - (31%) Gaps:145/341 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly  1064 EKKDKSKKADQIGLPSFKSDRKIK--ANDKRQKKEKKKDKDKQILVHIPDDTEEF--DKVPLANN 1124
            :|:.::|||:...|.| :...|:|  |:::|.:..||.|.       ..:..:||  |||.||  
Zfish    32 DKRTEAKKAEISELAS-EYIEKVKNLASEERVQHLKKIDS-------AYNKCKEFSDDKVQLA-- 86

  Fly  1125 DEPVLKSSSMTINPSLGAATSGISPNQIPKLTLKLSGKSTLFSSSEKEMTDAGKLKQTTILSSEN 1189
                     |.|.            ..:.|...:|..:...|.:..:|..|:|...     ||:.
Zfish    87 ---------MQIY------------EMVDKHIRRLDAELARFENDLQEKLDSGSQD-----SSDE 125

  Fly  1190 KKRERDNSPELARFSPLVTGPPKN-KQSETLHLGNSSTAVLPVPSPVAVRAVQLPVSQTSSNSAG 1253
            |:..:|                || |.....|..:..|:                 .|.|.....
Zfish   126 KQSRKD----------------KNMKDKRGSHARDKKTS-----------------DQDSPKQKK 157

  Fly  1254 WLSNPNNSNTASSTLSASSVLLPQQLMLAPHTIMNNFVPAMCNSTGTVSKSGLCSSPPNTSEENA 1318
            ..:.||.|.:                :||.|                                  
Zfish   158 MKNGPNISES----------------LLAMH---------------------------------- 172

  Fly  1319 NAMQIAESSRPSSYVD--AEGNRIWICPACGKVDDGSAMIGCDGCDA---WYHWICVGITFAPKD 1378
                      ||..:|  .:.|....| .|.:|..|. |||||..|.   |:|:.|||:...||.
Zfish   173 ----------PSDVLDMPVDPNEPTYC-LCSQVSYGE-MIGCDNSDCPIEWFHFACVGLATKPKG 225

  Fly  1379 NDDWFCRVCV--TKKR 1392
            .  |:|..|.  .||:
Zfish   226 K--WYCPRCTQDMKKK 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bip2NP_651923.2 BTP 4..80 CDD:128846
PHD_TAF3 1342..1387 CDD:276997 19/47 (40%)
ing5bNP_001007169.1 ING 6..105 CDD:289749 24/103 (23%)
TNG2 7..232 CDD:227367 68/332 (20%)
PHD_ING4_5 188..232 CDD:277061 19/47 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.