DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bip2 and Ing5

DIOPT Version :9

Sequence 1:NP_651923.2 Gene:bip2 / 43793 FlyBaseID:FBgn0026262 Length:1406 Species:Drosophila melanogaster
Sequence 2:NP_609647.1 Gene:Ing5 / 34752 FlyBaseID:FBgn0032516 Length:285 Species:Drosophila melanogaster


Alignment Length:384 Identity:81/384 - (21%)
Similarity:127/384 - (33%) Gaps:116/384 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly  1026 NYEDITITPTGLTSLEPKMRKHHKKLKKVKEGKNKKKK----EKKDKSKKADQIGLPSFKSDRKI 1086
            ||.|      ||.||..::.::.|.::|:.:......|    ..||..:|..:.|..| :.:|:.
  Fly     9 NYLD------GLESLPTELERNFKLMRKLDDRAQTAMKSIDSHAKDFMRKLGENGAMS-EDERRE 66

  Fly  1087 KANDKRQKKEKKKDKDKQILVHIPDDTEEFDKVPLANNDEPVLKSSSMTINPSLGAATSGISPNQ 1151
            :..|.:....|.|:...             |||.||                   ..|..:...|
  Fly    67 RQEDIKALFGKAKEYSD-------------DKVQLA-------------------IQTYELVDKQ 99

  Fly  1152 IPKLTLKLSGKSTLFSSSEKEMTDAGKLKQTTILSSENKKRERDNSPELARFSPLVTGPPKNKQS 1216
            |.:|...|:    .|....:|...:.:.|...:::.:.:|:.:|:.         .||..|...|
  Fly   100 IRRLDNDLA----RFEGEIQEKASSTRAKSEEVVAKKGRKKTKDSK---------TTGKKKKSAS 151

  Fly  1217 ETLHLGNSSTAVLPVPSPVAVRAVQLPVSQTSSNSAGWLSNPNNSNTASSTLSASSVLLPQQLML 1281
            .....|..:..                            ||.|:|..:||.....|.....::  
  Fly   152 SDEETGRGNNQ----------------------------SNANSSVNSSSNAGQGSKKKKSKV-- 186

  Fly  1282 APHTIMNNFVPAMCNSTGTVSKSGLCSSPPNTSEENANAMQIAESSRPSSYVD--AEGNRIWICP 1344
                          |......|.|.........:....:...| ::.||..:|  .:.|....| 
  Fly   187 --------------NQEKETRKGGAQKKTVEVDDSEKESCHTA-ATHPSDVMDMPVDPNEPTYC- 235

  Fly  1345 ACGKVDDGSAMIGCDGCDA---WYHWICVGITFAPKDNDDWFCRVCVTKKRIHGSEKKK 1400
            .|.:|..|. |||||..|.   |:|:.|||:|..||..  |||..| |:.|     |||
  Fly   236 LCHQVSYGE-MIGCDNPDCPIEWFHFACVGLTTKPKGK--WFCPKC-TQDR-----KKK 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bip2NP_651923.2 BTP 4..80 CDD:128846
PHD_TAF3 1342..1387 CDD:276997 21/47 (45%)
Ing5NP_609647.1 TNG2 1..278 CDD:227367 75/369 (20%)
ING 6..108 CDD:289749 28/137 (20%)
PHD_ING4_5 234..278 CDD:277061 21/47 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5034
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.