DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bip2 and Taf8

DIOPT Version :9

Sequence 1:NP_651923.2 Gene:bip2 / 43793 FlyBaseID:FBgn0026262 Length:1406 Species:Drosophila melanogaster
Sequence 2:NP_523397.1 Gene:Taf8 / 32792 FlyBaseID:FBgn0022724 Length:328 Species:Drosophila melanogaster


Alignment Length:343 Identity:71/343 - (20%)
Similarity:120/343 - (34%) Gaps:77/343 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VVAQITQTIGYSCTLSAPLELLQDILQKFVQEFARDMHRHMEHANRIEPNLKDARLSIKNLSINV 78
            ||:|:....|.....:..||.|..:||..:.|.....|.:.|.:.|..|.:.|..|::.|:.|: 
  Fly    22 VVSQLLLDKGAGQASNHSLETLTQMLQALIWEIGNSAHNYCELSGRTMPTVGDVSLALINMGIS- 85

  Fly    79 QELLDYIGNVEPVGFIRDVPQFPIGKSVNMNFLKPGSAETLTRPV-------------YIFEYLP 130
                  |.|::|  ::|.....||.       |.|  .:|..||:             |:..|.|
  Fly    86 ------ISNLDP--YMRKETHVPIP-------LPP--QQTQQRPLSLLQAGIKAPHPHYVPSYFP 133

  Fly   131 PMQDPE------LREIPADVQKEFSEKQEFCSKAEYSSTNAADKLGAKHIDSISPNTVINFRSNA 189
            ||.||.      ..:.|....:...||.. |.|.:..  .|..|...|..::   |.:.....|.
  Fly   134 PMPDPHAYIRTPTHKQPVTEYEAIREKAA-CQKRDIE--KALTKFLCKTTET---NNLFPTEDNM 192

  Fly   190 FELDVGSSVREMSSVVMTTGGFISPAIEGKLPEDIIPDIVEKFLGLDAPFSPTIIVNSLQKSPQL 254
            |.|            :.....| .|......|.|.:.|..|    |:..:   ::.|..:..|..
  Fly   193 FPL------------IACKPAF-PPYAAALNPTDQVFDFEE----LEYHY---LVANRTEDEPSK 237

  Fly   255 ALSDRDKTVNPRKIIPSETKIFKQNAALLTSGHSESSIIYASN--NHTMLTVTTPKKNRKQKHDL 317
            ...:...:.| .::...::|..|....:..:.::..:|:...|  |..:...|.||:::.     
  Fly   238 DDGEEGDSEN-EEMDGDKSKEEKPELDIKPNSNTNKAILENPNIDNPYLRAATLPKRSKN----- 296

  Fly   318 ICE-----PGQSELLTNP 330
             |.     |.:|...|.|
  Fly   297 -CPTPGTMPSRSLATTAP 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bip2NP_651923.2 BTP 4..80 CDD:128846 18/65 (28%)
PHD_TAF3 1342..1387 CDD:276997
Taf8NP_523397.1 BTP 15..88 CDD:128846 19/72 (26%)
TAF8 126..179 CDD:176263 14/55 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2389
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1475
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.