DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Taf3 and ing4

DIOPT Version :10

Sequence 1:NP_651923.2 Gene:Taf3 / 43793 FlyBaseID:FBgn0026262 Length:1406 Species:Drosophila melanogaster
Sequence 2:NP_001018304.1 Gene:ing4 / 322113 ZFINID:ZDB-GENE-050522-47 Length:250 Species:Danio rerio


Alignment Length:274 Identity:64/274 - (23%)
Similarity:88/274 - (32%) Gaps:87/274 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly  1151 QIPKLTLKLSGKSTLFSSSEK------EMTDAGKLK-------QTTILSSEN-KKRERDNSPELA 1201
            ||..|..:.:..:...||.:|      .....||.|       |..:.:.|. .|..|....:||
Zfish    41 QIDSLAREYTANARTLSSEQKLSLLRQIQQSYGKCKEFGDDKVQLAMQTYEMVDKHIRRLDTDLA 105

  Fly  1202 RFSPLVTGPPKNKQSE------TLHLGNSSTAVLPVPSPVAVRAVQLPVSQTSSNSAGWLSNPNN 1260
            ||.    ...|.||.|      |...||.|.  :..|....|...:..|.             |:
Zfish   106 RFE----ADLKEKQIESTDYDSTSSKGNKSD--IRGPKKKEVNRARSKVK-------------NS 151

  Fly  1261 SNTASSTLSASSVLLPQQLMLAPHTIMNNFVPAMCNSTGTVSKSGLCSSPPNTSEENANAMQIAE 1325
            .:..||......|.|.|....:...:  ||        |.|..|.:...|.:.:|..        
Zfish   152 DDDCSSKSGQKKVKLTQSTEFSTPAV--NF--------GNVHPSDVLDMPVDPNEPT-------- 198

  Fly  1326 SSRPSSYVDAEGNRIWICPACGKVDDGSAMIGCDGCDA---WYHWICVGITFAPKDNDDWFCRVC 1387
                            .| .|.:|..|. |||||..|.   |:|:.|||:|..|:..  |:|..|
Zfish   199 ----------------YC-LCHQVSYGE-MIGCDNTDCSIEWFHFACVGLTTKPRGK--WYCPRC 243

  Fly  1388 VTKKRIHGSEKKKR 1401
                   ..|:||:
Zfish   244 -------SQERKKK 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Taf3NP_651923.2 HFD_TAF3 4..95 CDD:467041
TNG2 <1289..1387 CDD:227367 26/100 (26%)
PHD_TAF3 1342..1387 CDD:276997 19/47 (40%)
ing4NP_001018304.1 TNG2 7..246 CDD:227367 61/268 (23%)
ING_ING4 11..104 CDD:341095 13/62 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.