DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Taf3 and Cfp1

DIOPT Version :10

Sequence 1:NP_651923.2 Gene:Taf3 / 43793 FlyBaseID:FBgn0026262 Length:1406 Species:Drosophila melanogaster
Sequence 2:NP_572556.1 Gene:Cfp1 / 31880 FlyBaseID:FBgn0030121 Length:663 Species:Drosophila melanogaster


Alignment Length:43 Identity:20/43 - (46%)
Similarity:24/43 - (55%) Gaps:1/43 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly  1346 CGKVDDGSAMIGCDGCDAWYHWICVGIT-FAPKDNDDWFCRVC 1387
            |...|....|||||||:.|||..|:||| ...|....::||.|
  Fly    65 CRSSDCSRFMIGCDGCEEWYHGDCIGITEKEAKHIKQYYCRRC 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Taf3NP_651923.2 HFD_TAF3 4..95 CDD:467041
TNG2 <1289..1387 CDD:227367 19/41 (46%)
PHD_TAF3 1342..1387 CDD:276997 19/41 (46%)
Cfp1NP_572556.1 PHD_Cfp1 62..107 CDD:277028 19/41 (46%)
zf-CXXC 178..218 CDD:366873
CpG_bind_C 298..532 CDD:463514
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.