powered by:
Protein Alignment bip2 and CG17440
DIOPT Version :9
Sequence 1: | NP_651923.2 |
Gene: | bip2 / 43793 |
FlyBaseID: | FBgn0026262 |
Length: | 1406 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_572555.1 |
Gene: | CG17440 / 31879 |
FlyBaseID: | FBgn0030120 |
Length: | 366 |
Species: | Drosophila melanogaster |
Alignment Length: | 45 |
Identity: | 20/45 - (44%) |
Similarity: | 26/45 - (57%) |
Gaps: | 5/45 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 1346 CGKVDDGSAMIGCDGCDAWYHWICVGITFAPKDND---DWFCRVC 1387
|...|....|||||||:.|||..|:.|| .||.: :::||.|
Fly 43 CRSSDCSRFMIGCDGCEEWYHGDCIEIT--EKDAEHIKNYYCRRC 85
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45443718 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.