DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bip2 and CG17440

DIOPT Version :9

Sequence 1:NP_651923.2 Gene:bip2 / 43793 FlyBaseID:FBgn0026262 Length:1406 Species:Drosophila melanogaster
Sequence 2:NP_572555.1 Gene:CG17440 / 31879 FlyBaseID:FBgn0030120 Length:366 Species:Drosophila melanogaster


Alignment Length:45 Identity:20/45 - (44%)
Similarity:26/45 - (57%) Gaps:5/45 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly  1346 CGKVDDGSAMIGCDGCDAWYHWICVGITFAPKDND---DWFCRVC 1387
            |...|....|||||||:.|||..|:.||  .||.:   :::||.|
  Fly    43 CRSSDCSRFMIGCDGCEEWYHGDCIEIT--EKDAEHIKNYYCRRC 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bip2NP_651923.2 BTP 4..80 CDD:128846
PHD_TAF3 1342..1387 CDD:276997 19/43 (44%)
CG17440NP_572555.1 PHD_Cfp1 40..85 CDD:277028 19/43 (44%)
zf-CpG_bind_C 231..>278 CDD:289071
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443718
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.