DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bip2 and Ing4

DIOPT Version :9

Sequence 1:NP_651923.2 Gene:bip2 / 43793 FlyBaseID:FBgn0026262 Length:1406 Species:Drosophila melanogaster
Sequence 2:XP_006237411.1 Gene:Ing4 / 297597 RGDID:1309407 Length:249 Species:Rattus norvegicus


Alignment Length:270 Identity:63/270 - (23%)
Similarity:93/270 - (34%) Gaps:80/270 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly  1151 QIPKLTLKLSGKSTLFSSSEK-----EMTDA-GKLK-------QTTILSSEN-KKRERDNSPELA 1201
            :|.||..:....:...||.||     ::.:| ||.|       |..:.:.|. .|..|....:||
  Rat    41 EIDKLATEYMSSARSLSSEEKLALLRQIQEAYGKCKEFGDDKVQLAMQTYEMVDKHIRRLDTDLA 105

  Fly  1202 RFSPLVTGPPKNKQSETLHLGNSSTAVLPVPSPVAVRAVQLPVSQTSSNSAGWLSNPNNSNTASS 1266
            ||.    ...|.||.|:....:||:           :..:...:|....:|...|...||:..:.
  Rat   106 RFE----ADLKEKQIESSDYDSSSS-----------KGKRKGRTQKEKKAARARSKGKNSDEEAP 155

  Fly  1267 TLSASSVLLPQQLMLAPHTIMNNFVPAMCNSTGTVSKSGLCSSPPNTSEENANAMQIAESSRPSS 1331
            ..:...:.|.:                                   ||.|.........|..||.
  Rat   156 KAAQKKLKLVR-----------------------------------TSPEYGMPSVTFGSVHPSD 185

  Fly  1332 YVD--AEGNRIWICPACGKVDDGSAMIGCDGCDA---WYHWICVGITFAPKDNDDWFCRVCVTKK 1391
            .:|  .:.|....| .|.:|..|. |||||..|.   |:|:.|||:|..|:..  |||..|    
  Rat   186 VLDMPVDPNEPTYC-LCHQVSYGE-MIGCDNPDCSIEWFHFACVGLTTKPRGK--WFCPRC---- 242

  Fly  1392 RIHGSEKKKR 1401
               ..|:||:
  Rat   243 ---SQERKKK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bip2NP_651923.2 BTP 4..80 CDD:128846
PHD_TAF3 1342..1387 CDD:276997 20/47 (43%)
Ing4XP_006237411.1 TNG2 7..245 CDD:227367 60/264 (23%)
ING_ING4 11..104 CDD:341095 15/62 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.