DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bip2 and Ing2

DIOPT Version :9

Sequence 1:NP_651923.2 Gene:bip2 / 43793 FlyBaseID:FBgn0026262 Length:1406 Species:Drosophila melanogaster
Sequence 2:XP_006253193.1 Gene:Ing2 / 290744 RGDID:1307347 Length:316 Species:Rattus norvegicus


Alignment Length:269 Identity:65/269 - (24%)
Similarity:113/269 - (42%) Gaps:47/269 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  1160 SGKSTLFSSSEKEMTDAG--KLKQTTILSSEN---KKRERDNSPELARFSPLVTGPPKNKQSETL 1219
            |.:..|.:..|.....||  :.:|.|:...::   |.::.|:|.:..|....:.....|.|    
  Rat    70 SAQGPLAAVLEAREGGAGSARWRQETLKEIDDVYEKYKKEDDSNQKKRLQQHLQRALINSQ---- 130

  Fly  1220 HLGNSS----TAVLPVPSPVAVRAVQLPV-SQTSSNSAGWLSNPNNSNTAS--STLSASSVLLPQ 1277
            .||:..    |.:|.:   |..||.|:.: ||.       ..:|..|..||  |.:.:|.   |:
  Rat   131 ELGDEKIQIVTQMLEL---VENRARQMELHSQC-------FQDPAESERASDKSKMDSSQ---PE 182

  Fly  1278 QLMLAPHTIMNNFVPAMCNSTGTVSKSGLCSSPPNTSEENANAMQ----IAESSRPSSYVD--AE 1336
            :....|.....:....:|:.|..:..   |...|...:::.:|.:    .|:..|.:|.|:  .:
  Rat   183 RSSRRPRRQRTSESRDLCHMTNGIDD---CDDQPPKEKKSKSAKKKKRSKAKQEREASPVEFAID 244

  Fly  1337 GNRIWICPACGKVDDGSAMIGCDG--CD-AWYHWICVGITFAPKDNDDWFCRVC--VTKKRIHGS 1396
            .|....| .|.:|..|. |||||.  |. .|:|:.||.:|:.||..  |:|..|  .::|.:..|
  Rat   245 PNEPTYC-LCNQVSYGE-MIGCDNEQCPIEWFHFSCVSLTYKPKGK--WYCPKCRGDSEKTMDKS 305

  Fly  1397 EKKKRRNKK 1405
            .:|.|:.::
  Rat   306 TEKTRKERR 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bip2NP_651923.2 BTP 4..80 CDD:128846
PHD_TAF3 1342..1387 CDD:276997 19/47 (40%)
Ing2XP_006253193.1 ING <93..157 CDD:289749 16/70 (23%)
PHD_ING2 249..297 CDD:277153 20/51 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.