DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bip2 and Ing1

DIOPT Version :9

Sequence 1:NP_651923.2 Gene:bip2 / 43793 FlyBaseID:FBgn0026262 Length:1406 Species:Drosophila melanogaster
Sequence 2:NP_036049.2 Gene:Ing1 / 26356 MGIID:1349481 Length:279 Species:Mus musculus


Alignment Length:448 Identity:79/448 - (17%)
Similarity:139/448 - (31%) Gaps:190/448 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   976 SLAGGADLIPLSRVSDSEYSSKIVPFSSLGGTIPNQIKISEEHNIFSTFSNYEDITITPTGLTSL 1040
            |.|.|..:..::.|.|...|.:.:||.     :...:.:..|.:     :.|::|      |..|
Mouse     3 SPANGEQIHLVNYVEDYLDSIESLPFD-----LQRNVSLMREID-----AKYQEI------LKEL 51

  Fly  1041 EPKMRKHHKKLKKVKEGKNKKKKEK--KDKSKKADQIGLPSFKSDRKIKANDKRQKKEKKKDKDK 1103
            :    .:::|.|:..:|..|::...  :....::.::|      |.||:.  ..|..|..:::.:
Mouse    52 D----DYYEKFKRETDGTQKRRVLHCIQRALIRSQELG------DEKIQI--VSQMVELVENRSR 104

  Fly  1104 QILVHIPDDTEEFDKVPLANNDEPVLKSSSMTINPSLGAATSGISPNQIPKLTLKLSGKSTLFSS 1168
            |:..|:    |.|:    |:.|              :...|.|             |||:....|
Mouse   105 QVDSHV----ELFE----AHQD--------------ISDGTGG-------------SGKAGQDKS 134

  Fly  1169 SEKEMTDAGKLKQTTILSSENKKR--------ERDNSPELARFSPLVTGPPKNKQSETLHLGNSS 1225
            ..:.:|.|.|         .|.||        .|:|:........:.:|.||.|:::|       
Mouse   135 KSEAITQADK---------PNNKRSRRQRNNENRENASNNHDHDDITSGTPKEKKAKT------- 183

  Fly  1226 TAVLPVPSPVAVRAVQLPVSQTSSNSAGWLSNPNNSNTASSTLSASSVLLPQQLMLAPHTIMNNF 1290
                                          |.....:.|.:...||    |..|.:.|:.     
Mouse   184 ------------------------------SKKKKRSKAKAEREAS----PADLPIDPNE----- 209

  Fly  1291 VPAMCNSTGTVSKSGLCSSPPNTSEENANAMQIAESSRPSSYVDAEGNRIWICPACGKVDDGSAM 1355
             |..|                                                 .|.:|..|. |
Mouse   210 -PTYC-------------------------------------------------LCNQVSYGE-M 223

  Fly  1356 IGCDGCDA---WYHWICVGITFAPKDNDDWFCRVC------VTKKRIHGSEKKKRRNK 1404
            ||||..:.   |:|:.|||:...||..  |:|..|      ...|.:..|:|::..|:
Mouse   224 IGCDNDECPIEWFHFSCVGLNHKPKGK--WYCPKCRGESEKTMDKALEKSKKERAYNR 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bip2NP_651923.2 BTP 4..80 CDD:128846
PHD_TAF3 1342..1387 CDD:276997 17/47 (36%)
Ing1NP_036049.2 ING 15..111 CDD:315637 22/127 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 115..206 27/167 (16%)
PHD_ING1_2 212..256 CDD:277059 18/95 (19%)
PBR. /evidence=ECO:0000250|UniProtKB:Q9H160 262..279 3/16 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.