DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bip2 and phf-34

DIOPT Version :9

Sequence 1:NP_651923.2 Gene:bip2 / 43793 FlyBaseID:FBgn0026262 Length:1406 Species:Drosophila melanogaster
Sequence 2:NP_509661.1 Gene:phf-34 / 184793 WormBaseID:WBGene00009025 Length:246 Species:Caenorhabditis elegans


Alignment Length:232 Identity:57/232 - (24%)
Similarity:82/232 - (35%) Gaps:57/232 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly  1206 LVTGP-----------PKNKQSETLHLGNSSTAVLPVPSPVAVRAVQLPVS------QTSSNSAG 1253
            |.|||           .:..:...|:||    .:|..|.|..:||.:..:.      ..|..:|.
 Worm    21 LCTGPVTVLEQALEQLERYPERGHLYLG----PILFGPEPYKLRACKTCIRLARHGLSASRFTAE 81

  Fly  1254 WLSN-----PNN-----SNTASSTLSASSVLLPQQL--MLAPH--TIMNNFVPAMCNST--GTVS 1302
            .:.|     |.:     |...:...:|....|.:||  |.|.|  .|....:.....||  ..|.
 Worm    82 EIENMTELCPTHLDEQLSEERAKAKAALEAKLAKQLKQMQAKHRKEIKEAEMAKTIRSTKKTKVG 146

  Fly  1303 KSGLCSSPPNTSEENANAMQIAESSRPSSYVDAEG----------------NRIWICPACGKVDD 1351
            |:|..:.....:.:.....|:.:..:|...::.|.                .| ||||.|.|...
 Worm   147 KNGKIAKVDKKTAKTVKEKQVLDLPQPKIEINDEDIDQYILEQAAPKKKNVTR-WICPTCDKSSK 210

  Fly  1352 -GSAMIGCDGCDAWYHWICVGITFAPKDNDDWFCRVC 1387
             ||.  ||.||..|||..|||...|.:..|.|.|:.|
 Worm   211 FGSC--GCVGCGDWYHITCVGFKKAKEVPDKWACKYC 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bip2NP_651923.2 BTP 4..80 CDD:128846
PHD_TAF3 1342..1387 CDD:276997 21/45 (47%)
phf-34NP_509661.1 PHD 201..245 CDD:214584 21/45 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5668
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.850

Return to query results.
Submit another query.