DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bip2 and lsy-13

DIOPT Version :9

Sequence 1:NP_651923.2 Gene:bip2 / 43793 FlyBaseID:FBgn0026262 Length:1406 Species:Drosophila melanogaster
Sequence 2:NP_001367153.1 Gene:lsy-13 / 178470 WormBaseID:WBGene00020287 Length:247 Species:Caenorhabditis elegans


Alignment Length:265 Identity:49/265 - (18%)
Similarity:94/265 - (35%) Gaps:53/265 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly  1165 LFSSSEKEMTDAGK-----LKQTTILSSENKKRERDNSPELARFSPLVTGPPKNK-----QSETL 1219
            :||...:|:.:..|     :::..||:.:..:..:.:..|.......:|...|.|     |.:..
 Worm    13 VFSKINREVPEKAKKAIVEIERLDILAKKEMEVAKKHKIEFFANYEEMTAEQKTKAFTFMQKKMA 77

  Fly  1220 HLGNSSTAVLPVPSPVAVRAVQLPVSQTSSNSAGWLSNPNNSNTASSTLSASSVLLPQQLMLAPH 1284
            .:...|...:.:.|.:.|....: ..:.......::.|.|....|..|..:||            
 Worm    78 KVSEYSDQKIEIASGLKVLLKDV-YGKFMEEEQKFIENLNKIPKAPETPPSSS------------ 129

  Fly  1285 TIMNNFVPAMCNSTGTVSKSGLCSSPPNTSEENANAMQIAESSRPSSYVDAEGNRIWICPACGKV 1349
                   |::.:........|...:|.:..|:.....:..||.:..:..:......|    | ::
 Worm   130 -------PSVRSHRKKKLSEGDDDAPSSVDEKKRGRKKKPESEKAVAAAEPPKMYCW----C-QL 182

  Fly  1350 DDGSAMIGCD--GCD-AWYHWICVGITFAPKDNDDWFCRVCVTKKRIHG----------SEKKKR 1401
            |....||.|:  ||. .|:|:.|:|:..||.  .||:   |..:.|..|          :.::|.
 Worm   183 DKNDTMIECENPGCKYGWFHFTCIGMITAPA--GDWY---CTNECRAQGLAAVAEAPQKAPQRKG 242

  Fly  1402 RNKKK 1406
            ..|||
 Worm   243 LKKKK 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bip2NP_651923.2 BTP 4..80 CDD:128846
PHD_TAF3 1342..1387 CDD:276997 15/47 (32%)
lsy-13NP_001367153.1 PHD_SF 177..222 CDD:419867 17/54 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.