DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and STK17A

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_004751.2 Gene:STK17A / 9263 HGNCID:11395 Length:414 Species:Homo sapiens


Alignment Length:364 Identity:123/364 - (33%)
Similarity:184/364 - (50%) Gaps:44/364 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LGTGAFSEVRLAESKDSPGEHFAVKIIDKKALKGKEESLE--NEIRVLRRFSANHFDGKCLNGTR 99
            ||.|.|:.||....||| |:.||.|.: :|..||::..:|  :||.||.....|           
Human    67 LGRGKFAVVRKCIKKDS-GKEFAAKFM-RKRRKGQDCRMEIIHEIAVLELAQDN----------- 118

  Fly   100 LTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIV--EKGSYTEKDASHLIRQILEAVDYMHEQ 162
               |.::.|.|.||..|::.||:|...|||:||:.|  .:.::.|||...|:|||||.|.::|.:
Human   119 ---PWVINLHEVYETASEMILVLEYAAGGEIFDQCVADREEAFKEKDVQRLMRQILEGVHFLHTR 180

  Fly   163 GVVHRDLKPENLLYYSPDDDSKIMISDFGLSK-MEDSGIMATACGTPGYVAPEVLAQKPYGKAVD 226
            .|||.||||:|:|..|......|.|.|||||: :::|..:....|||.|||||:|:..|...|.|
Human   181 DVVHLDLKPQNILLTSESPLGDIKIVDFGLSRILKNSEELREIMGTPEYVAPEILSYDPISMATD 245

  Fly   227 VWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDSPYWDEISESAKHFIKNLMCVTVEKRY 291
            :|||||::|::|.|..||...:....|..|.:.:..:....:|.:||||..||:.|:....|.|.
Human   246 MWSIGVLTYVMLTGISPFLGNDKQETFLNISQMNLSYSEEEFDVLSESAVDFIRTLLVKKPEDRA 310

  Fly   292 TCKQALGHAWISGNEASSRNIHGTVSEQLKKNFAKSRWKQAYYAATVIRQMQRMALNSNSNANFD 356
            |.::.|.|.|:            |.|...:.:|   |.::|...|..:::.     :|....|.|
Human   311 TAEECLKHPWL------------TQSSIQEPSF---RMEKALEEANALQEG-----HSVPEINSD 355

  Fly   357 SSNSSNQDSTTPTAATGAWTSNVLSSQQSVQSHAQEMNK 395
            :..|..::|.. |......||..|.  |..||..::|.:
Human   356 TDKSETKESIV-TEELIVVTSYTLG--QCRQSEKEKMEQ 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 103/268 (38%)
S_TKc 31..302 CDD:214567 103/269 (38%)
STK17ANP_004751.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40
STKc_DRAK1 51..321 CDD:271099 103/269 (38%)
S_TKc 64..321 CDD:214567 103/269 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 342..363 4/25 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.