DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and DCLK1

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_001317000.1 Gene:DCLK1 / 9201 HGNCID:2700 Length:740 Species:Homo sapiens


Alignment Length:377 Identity:138/377 - (36%)
Similarity:212/377 - (56%) Gaps:37/377 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KDLKELNKQV--SIEEKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKIIDKKALKGKEESLENE 78
            :::.|...|:  :|.|:|.:...:|.|.|:.|:....: |....:|:|||.|...:|||..::||
Human   373 EEVSEEGFQIPATITERYKVGRTIGDGNFAVVKECVER-STAREYALKIIKKSKCRGKEHMIQNE 436

  Fly    79 IRVLRRFSANHFDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEK 143
            :.:||               |:.|||||.|:|..:..:::|||||||.||:|||.|.....|||:
Human   437 VSILR---------------RVKHPNIVLLIEEMDVPTELYLVMELVKGGDLFDAITSTNKYTER 486

  Fly   144 DASHLIRQILEAVDYMHEQGVVHRDLKPENLLYYSPDDDSK-IMISDFGLSKMEDSGIMATACGT 207
            |||.::..:..|:.|:|...:||||:||||||.|...|.|| :.:.||||:.:.| |.:.|.|||
Human   487 DASGMLYNLASAIKYLHSLNIVHRDIKPENLLVYEHQDGSKSLKLGDFGLATIVD-GPLYTVCGT 550

  Fly   208 PGYVAPEVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDENDAN--LFAQILKGDFEFDSPYWDE 270
            |.|||||::|:..||..||:|:.|||:||||||:|||....|..  ||.|||.|..:|.|||||.
Human   551 PTYVAPEIIAETGYGLKVDIWAAGVITYILLCGFPPFRGSGDDQEVLFDQILMGQVDFPSPYWDN 615

  Fly   271 ISESAKHFIKNLMCVTVEKRYTCKQALGHAWISGNEASSRNIHGTVSEQLKKNFAKSRWKQAYYA 335
            :|:|||..|..::.|.|::|::..|.|.|.|::.:.........:|:.::||:|.......:..|
Human   616 VSDSAKELITMMLLVDVDQRFSAVQVLEHPWVNDDGLPENEHQLSVAGKIKKHFNTGPKPNSTAA 680

  Fly   336 ATVI---------RQMQRMALNSNSNANFDSS------NSSNQDSTTPTAAT 372
            ...:         ||:.|...|.:..:.:.:.      ||.::|.:..::.|
Human   681 GVSVIATTALDKERQVFRRRRNQDVRSRYKAQPAPPELNSESEDYSPSSSET 732

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 122/276 (44%)
S_TKc 31..302 CDD:214567 120/273 (44%)
DCLK1NP_001317000.1 DCX1_DCLK1 55..143 CDD:340660
DCX2 182..265 CDD:340589
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 287..378 0/4 (0%)
STKc_DCKL1 383..650 CDD:271085 123/283 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 697..740 6/36 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.