DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and TDA1

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_014019.1 Gene:TDA1 / 855336 SGDID:S000004905 Length:586 Species:Saccharomyces cerevisiae


Alignment Length:455 Identity:111/455 - (24%)
Similarity:187/455 - (41%) Gaps:108/455 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SGKKAKAKDLKELNKQVSIEEKY-NLHGLLGTGAFSEVRLA---ESKDSPGEHFAVKIIDKKALK 69
            ||..|.|:..|         .|| ..|..||.|.||.|:..   .:||.    :|:|:|.|:.:|
Yeast    25 SGSNADAQTFK---------CKYVTNHNSLGDGNFSVVKECMNIHTKDL----YAMKLIKKQTVK 76

  Fly    70 GKEESLENEIRVLRRFSANHFDGKCLNGTRLT----HPNIVQLLETYEDKSKVYLVMELVTGGEL 130
            .|.:.::.|..:||..|....|.:..|...|.    |.:|:||.:.:|....:.|:.:|...|:|
Yeast    77 NKIQLIQREFDLLRSISEKIRDMEKKNEHSLDIFEGHHHILQLFDYFETADNIVLITQLCQKGDL 141

  Fly   131 FDRIVEKGSY-TEKDASHLIRQILEAVDYMHEQGVVHRDLKPENLLYYSPDDDSK---------- 184
            :::|||.... .|...:.....::..::::|.||:||||||.||:|:....::::          
Yeast   142 YEKIVENQCLDLETQVTSYCACLVSVLEFLHSQGIVHRDLKAENVLFRLRVNENEKNLQGEHHGD 206

  Fly   185 ---------IMISDFGL------SKMEDSGIMATACGTPGYVAPEVLAQK--------------P 220
                     ::::||||      ||:..   :....||..|:|||::..|              .
Yeast   207 FKYDLLAHDLVLADFGLAAEYNTSKVNS---LKEFVGTISYIAPEIVKCKGVGEMTPDQVGKLDK 268

  Fly   221 YGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDSPYW-DEISESAKHFIKNLMC 284
            ||..||:|::||::|.:..||.||....|......|.|.|:..|.... |...|...:|::  .|
Yeast   269 YGCPVDIWALGVLTYFMAFGYTPFDCTTDDETLECISKCDYYVDEQMMHDPKYEQFWNFVQ--CC 331

  Fly   285 VTVEK--RYTCKQALGHAWISGNEASS-----------------RNIHGTVSEQLKKNFAKSRWK 330
            .|::.  |.:.|....|.:|....|:|                 |.:..|.|....::.:|||  
Yeast   332 FTIDPAVRRSAKNLKQHPFIKDYFATSNSLNTKDTPNFSFHPTIRRVSSTASMHTLRSPSKSR-- 394

  Fly   331 QAYYAATVIRQMQRMALNSNSNANFDSSNSSNQDSTTPTAATGAWTSNVLSSQQSVQSHAQEMNK 395
                ..|.:..:           |.|..:|.     |.||.:.......|...:::.|..:.:|:
Yeast   395 ----KTTTLAYL-----------NMDGGSSE-----TSTAFSSKMDLPDLYVDRTINSRERSLNR 439

  Fly   396  395
            Yeast   440  439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 87/324 (27%)
S_TKc 31..302 CDD:214567 86/321 (27%)
TDA1NP_014019.1 STKc_CAMK 37..350 CDD:270687 87/321 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24347
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.