DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and PSKH2

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:XP_016869418.1 Gene:PSKH2 / 85481 HGNCID:18997 Length:504 Species:Homo sapiens


Alignment Length:362 Identity:141/362 - (38%)
Similarity:206/362 - (56%) Gaps:52/362 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GKKDSGKKAKAKDLKELNK-QVSIEEKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKIIDKKAL 68
            |||.:|..|        || :.|...:|::..|:|||:||.|...|.|.:. :.||:|:::.:..
Human   163 GKKRAGAAA--------NKGRNSYLRRYDIKALIGTGSFSRVVRVEQKTTK-KPFAIKVMETRER 218

  Fly    69 KGKEESLENEIRVLRRFSANHFDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDR 133
            :|:|..: :|:.||||.|               |..||||:|.:|.:.:||:||||.||||||||
Human   219 EGREACV-SELSVLRRVS---------------HRYIVQLMEIFETEDQVYMVMELATGGELFDR 267

  Fly   134 IVEKGSYTEKDASHLIRQILEAVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLS---KM 195
            ::.:||:||:||..:::.:.:.:.|:|...:.||:|||||||||.|.::|||:|:||||:   |.
Human   268 LIAQGSFTERDAVRILQMVADGIRYLHALQITHRNLKPENLLYYHPGEESKILITDFGLAYSGKK 332

  Fly   196 EDSGIMATACGTPGYVAPEVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGD 260
            .....|.|.||||.|:|||||.:|||..|||:|::|||:|.||.|:.||.||:...|:.:||||.
Human   333 SGDWTMKTLCGTPEYIAPEVLLRKPYTSAVDMWALGVITYALLSGFLPFDDESQTRLYRKILKGK 397

  Fly   261 FEFDSPYWDEISESAKHFIKNLMCVTVEKRYTCKQALGHAWISGNEASS--RNIHGTVSEQLKKN 323
            :.:....|..||..||.||..|:.:....|.:..|||.|.|:....|.|  :|:...:|..|   
Human   398 YNYTGEPWPSISHLAKDFIDKLLILEAGHRMSAGQALDHPWVITMAAGSSMKNLQRAISRNL--- 459

  Fly   324 FAKSRWKQAYYAATVIRQMQRMALNSNSNANFDSSNS 360
                              |||.:.:|.|..:..||.|
Human   460 ------------------MQRASPHSQSPGSAQSSKS 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 119/276 (43%)
S_TKc 31..302 CDD:214567 119/273 (44%)
PSKH2XP_016869418.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 1 1.000 - - FOG0000163
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.