DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and MEK1

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_014996.3 Gene:MEK1 / 854533 SGDID:S000005878 Length:497 Species:Saccharomyces cerevisiae


Alignment Length:342 Identity:109/342 - (31%)
Similarity:176/342 - (51%) Gaps:57/342 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LLGTGAFSEVRL---AESKDSP----GEHFAVKIIDKKALKGKEESLENEIRVLRRFSANHFDGK 93
            ::|.|.|..|.:   ::.:|..    .|::|||||     |.|....:.|.|:|           
Yeast   167 IVGNGTFGHVLITHNSKERDEDVCYHPENYAVKII-----KLKPNKFDKEARIL----------- 215

  Fly    94 CLNGTRLTHPNIVQLLETYEDKSK-VYLVMELVTGGELFDRIVEKG----SYTEKDASHLIRQIL 153
                .||.||||:::..|:.|::. :|:..:|:.||:||..:. ||    |.:|.::..::.|||
Yeast   216 ----LRLDHPNIIKVYHTFCDRNNHLYIFQDLIPGGDLFSYLA-KGDCLTSMSETESLLIVFQIL 275

  Fly   154 EAVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLSKMEDSG--IMATACGTPGYVAPEV- 215
            :|::|:|:|.:||||||.:|:|..:|:..::|:::|||::|..:|.  .|.|..|||.|.|||| 
Yeast   276 QALNYLHDQDIVHRDLKLDNILLCTPEPCTRIVLADFGIAKDLNSNKERMHTVVGTPEYCAPEVG 340

  Fly   216 ----------------LAQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILK-GDFEF 263
                            |.|:.|....|:||:|||::|:|.|..|||.:.......|..| |...|
Yeast   341 FRANRKAYQSFSRAATLEQRGYDSKCDLWSLGVITHIMLTGISPFYGDGSERSIIQNAKIGKLNF 405

  Fly   264 DSPYWDEISESAKHFIKNLMCVTVEKRYTCKQALGHAWISGNEASSRNIHGTV----SEQLKKNF 324
            ....||.:|::||.|:|:|:...|.||...||.|.|.||:.:.:....::...    :|..|...
Yeast   406 KLKQWDIVSDNAKSFVKDLLQTDVVKRLNSKQGLKHIWIAKHLSQLERLYYKKILCNNEGPKLES 470

  Fly   325 AKSRWKQAYYAATVIRQ 341
            ..|.||:....:.:|.|
Yeast   471 INSDWKRKLPKSVIISQ 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 100/296 (34%)
S_TKc 31..302 CDD:214567 100/297 (34%)
MEK1NP_014996.3 FHA 28..122 CDD:238017
STKc_CAMK 160..443 CDD:270687 100/296 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24347
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.