DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and NNK1

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_012750.1 Gene:NNK1 / 853683 SGDID:S000001654 Length:928 Species:Saccharomyces cerevisiae


Alignment Length:438 Identity:98/438 - (22%)
Similarity:167/438 - (38%) Gaps:90/438 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PLFGKKDSGKKAKAKDLKELNKQVSIEEKYNLHGLLGTGAFSEVRLAESKD-SPGEHFAVKIIDK 65
            ||.|......:...|.::.|.        :.|..::|.||:..:|  |..| ..|....:||:..
Yeast   428 PLSGSAGGSARPDDKGMEILG--------HRLGKIIGFGAWGIIR--ECFDIETGVGRVIKIVKF 482

  Fly    66 KALKGKEESLENEIRVLRRFSANHFDGKCLNGTRLTHPNIVQLLE-TYEDKSKVYLVMELVTGGE 129
            |..:..::.:..|:.:.|               .|.|..|:.||: ..:|...:|.:.|.:..|.
Yeast   483 KGHQNIKKHVLREVAIWR---------------TLKHNRILPLLDWKLDDNYAMYCLTERINDGT 532

  Fly   130 LFDRIVEKGSYTEKDAS------------HLIRQILEAVDYMHEQGVVHRDLKPENLLYY--SPD 180
            |:|.::   |:.|...|            .|..|:|.|:.|||.:.:||.|:|.||.|..  ...
Yeast   533 LYDLVI---SWDEFKRSKIPFAERCRLTIFLSLQLLSALKYMHSKTIVHGDIKLENCLLQKEGKK 594

  Fly   181 DDSKIMISDFGLSKMEDSGIMATACGTPGYVAPEVLAQKPYGKAVDVWSIG-------VISYILL 238
            .|.|:.:.|||:|...|.              ..|.....:.:.:   |.|       .|....|
Yeast   595 SDWKVFLCDFGMSCHFDE--------------KHVYRNDTFDENL---SSGNSHRKRKSIEQTNL 642

  Fly   239 CGYPP--FYDENDANLF--AQILKGDFE--FDSPYWDE-ISESAKHFIKNLMCVTVEKRYTCKQA 296
            ..||.  |..::..|.|  ::.||..||  ...|:..: :..|:.|.:|:|.    :...:....
Yeast   643 IKYPTTNFLPDDRTNDFDASENLKYQFENRKHQPFTPKGMVSSSSHSLKHLN----QPSSSSSSN 703

  Fly   297 LGHAWISGNEASSRN-IHG----TVSEQLKKNFAKSRWKQAYYAATVIRQMQRMALNSNSNANFD 356
            |.|...|..:...|: .||    |....|:...:|......|.:..::|........|.....:|
Yeast   704 LFHKPASQPQPQHRSPFHGRHKTTDFSNLEPEPSKYIGSLPYASPELLRYSDARRSKSVEMHIYD 768

  Fly   357 SSNSSNQDSTTPTAATGAWTSNVLSSQQSVQSHAQEMNKSGGSTNAAS 404
            |.:||..:    .:|..:.:||:.|...|.::.|  :..||.:|::.|
Yeast   769 SPDSSQSE----ISAASSSSSNLSSLSSSTKASA--VTNSGVTTSSPS 810

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 69/303 (23%)
S_TKc 31..302 CDD:214567 69/300 (23%)
NNK1NP_012750.1 PKc 455..>613 CDD:270622 47/191 (25%)
PKc_like <817..864 CDD:419665
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.