DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and RCK1

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_011357.1 Gene:RCK1 / 852719 SGDID:S000003126 Length:512 Species:Saccharomyces cerevisiae


Alignment Length:393 Identity:129/393 - (32%)
Similarity:191/393 - (48%) Gaps:66/393 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KAKDLKELNKQVSIE---EKYNLHGLLGTGAFSEVRLAESKDSPGE-HFAVKIIDKKA------L 68
            |:.|....|.|...:   ..|.|...:|.||||.|..|...::..: ..|:|.|.||.      |
Yeast   101 KSTDYSSSNHQYPEQLELHNYKLLNKIGEGAFSRVFKAVGINTDDQAPVAIKAIIKKGISSDAIL 165

  Fly    69 KGKE-------ESLENEIRVLRRFSANHFDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVT 126
            ||.:       :.:.||:.:.:..|.|             :|:..:.:...|..:..|||.||||
Yeast   166 KGNDRIQGSSRKKVLNEVAIHKLVSKN-------------NPHCTKFIAFQESANYYYLVTELVT 217

  Fly   127 GGELFDRIVEKGSYTEKDASHLIRQILEAVDYMHEQGVVHRDLKPENLL-----YYSPDDDSK-- 184
            |||:|||||:...::|..|.|:|.|:..|:.:||..|:||||:||||||     :|..|.|.:  
Yeast   218 GGEIFDRIVQLTCFSEDLARHVITQVAIAIKHMHYMGIVHRDVKPENLLFEPIPFYGLDGDMQKE 282

  Fly   185 --------------IMISDFGLSKMEDSGIMATACGTPGYVAPEVLAQKPYGKAVDVWSIGVISY 235
                          :.:.||||:|...:....|.|||..|||.||...|.|...||:||||.:.:
Yeast   283 DEFTLGVGGGGIGLVKLMDFGLAKKLRNNTAKTPCGTIEYVASEVFTSKRYSMKVDMWSIGCVLF 347

  Fly   236 ILLCGYPPFYDENDANLFAQILKGDFEFDSPYWDEISESAKHFIKNLMCVTVEKRYTCKQALGHA 300
            .|||||||||::|:..|..:|.:||:||.:|:||.||..||:.:.:|:.|...|||.....|...
Yeast   348 TLLCGYPPFYEKNEKTLLKKISRGDYEFLAPWWDNISSGAKNAVTHLLEVDPNKRYDIDDFLNDP 412

  Fly   301 WISGNEA---SSRNIHGTVSEQLKKNFAKSRWKQAYYAATVIRQMQRMALNSNSNANFDSSNSSN 362
            |::..:.   |:.|.:.:|...|..:|.:.       |.|:     ..||:..|....|:..|.:
Yeast   413 WLNSYDCLKDSNSNSYASVQSILNDSFDER-------AETL-----HCALSCQSEKQDDTEFSRS 465

  Fly   363 QDS 365
            :.|
Yeast   466 ESS 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 111/311 (36%)
S_TKc 31..302 CDD:214567 111/305 (36%)
RCK1NP_011357.1 STKc_RCK1-like 119..414 CDD:270998 111/307 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.