DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and DUN1

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_010182.1 Gene:DUN1 / 851457 SGDID:S000002259 Length:513 Species:Saccharomyces cerevisiae


Alignment Length:354 Identity:128/354 - (36%)
Similarity:192/354 - (54%) Gaps:60/354 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PLFGKKDSGKKAKAKDLKELNK--QVSIEEKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKII- 63
            |......|.....:..:::|||  .||..:||.|...||.|.::.|:.|::|.: |:..||||. 
Yeast   169 PQISATSSQNATTSAAIRKLNKTRPVSFFDKYLLGKELGAGHYALVKEAKNKKT-GQQVAVKIFH 232

  Fly    64 -----DKKALKGKEESLENEIRVLRRFSANHFDGKCLNGTRLTHPNIVQLLETYED---KSKV-- 118
                 |:|    |.:....|..:|               .|:.|||||.||:::.:   ||::  
Yeast   233 AQQNDDQK----KNKQFREETNIL---------------MRVQHPNIVNLLDSFVEPISKSQIQK 278

  Fly   119 YLVMELVTGGELFDRIVEKGSYTEKDASHLIRQILEAVDYMHEQGVVHRDLKPENLLY------- 176
            |||:|.:..||||:|||.|....:.::..|.:|:|..:.|:|||.::|||:||||:|.       
Yeast   279 YLVLEKIDDGELFERIVRKTCLRQDESKALFKQLLTGLKYLHEQNIIHRDIKPENILLNITRREN 343

  Fly   177 --------YSPDD-DSKIMISDFGLSKMEDSGIMA---TACGTPGYVAPEVLAQKPYGKAVDVWS 229
                    :..|: |.::.|:||||:|.  :|.|.   |.||||.|||||||.:|.|...||:||
Yeast   344 PSQVQLGPWDEDEIDIQVKIADFGLAKF--TGEMQFTNTLCGTPSYVAPEVLTKKGYTSKVDLWS 406

  Fly   230 IGVISYILLCGYPPFYDE-NDANLFAQILKGDFEFDSPYWDEISESAKHFIKNLMCVTVEKRYTC 293
            .|||.|:.|||:|||.|: ...:|..|||:..:.|.|||||:|.:|..|.|.||:.:..::||..
Yeast   407 AGVILYVCLCGFPPFSDQLGPPSLKEQILQAKYAFYSPYWDKIDDSVLHLISNLLVLNPDERYNI 471

  Fly   294 KQALGHAWISGNEASSRNIHGTVSEQLKK 322
            .:||.|.|.:..:..|     :||.:|::
Yeast   472 DEALNHPWFNDIQQQS-----SVSLELQR 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 116/304 (38%)
S_TKc 31..302 CDD:214567 115/301 (38%)
DUN1NP_010182.1 FHA 36..136 CDD:238017
STKc_CAMK 199..479 CDD:270687 116/301 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2171
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.