DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and Dcx

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:XP_006257444.1 Gene:Dcx / 84394 RGDID:620670 Length:366 Species:Rattus norvegicus


Alignment Length:253 Identity:52/253 - (20%)
Similarity:84/253 - (33%) Gaps:83/253 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LNKQVSIEEKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKIIDKKALKGKEESLENEIRVLRRF 85
            :|....:...|.:.|....|:..|:...||.....::|..|:          |..:|   |...:
  Rat    95 INLPQGVRYIYTIDGSRKIGSMDELEEGESYVCSSDNFFKKV----------EYTKN---VNPNW 146

  Fly    86 SANHFDGKCLNGTR-LTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKG--------SYT 141
            |.|......:...: |...|..|..|     :|.::..:|||       |:..|        ...
  Rat   147 SVNVKTSANMKAPQSLASSNSAQARE-----NKDFVRPKLVT-------IIRSGVKPRKAVRVLL 199

  Fly   142 EKDASHLIRQIL----EAVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLSKMEDSGIMA 202
            .|..:|...|:|    ||:..  |.|||.:        .|:.|......:.||    ..|..:. 
  Rat   200 NKKTAHSFEQVLTDITEAIKL--ETGVVKK--------LYTLDGKQVTCLHDF----FGDDDVF- 249

  Fly   203 TACGTPGYVAPEVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGD 260
            .|||      ||     .:..|.|.:|:               |||:    .:::||:
  Rat   250 IACG------PE-----KFRYAQDDFSL---------------DENE----CRVMKGN 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 51/247 (21%)
S_TKc 31..302 CDD:214567 51/243 (21%)
DcxXP_006257444.1 DCX1_DCX 51..139 CDD:340529 10/53 (19%)
DCX2 176..259 CDD:340589 25/115 (22%)
KLF8_12_N <284..>343 CDD:424081
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.