DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and CPK30

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_177612.2 Gene:CPK30 / 843813 AraportID:AT1G74740 Length:541 Species:Arabidopsis thaliana


Alignment Length:346 Identity:133/346 - (38%)
Similarity:185/346 - (53%) Gaps:25/346 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LNKQVSIEEKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKIIDKKALKG--KEESLENEIRVLR 83
            ::.|..|.:||.|...||.|.|....|...::: .|..|.|.|.|:.|:.  ..|.:..|:.:: 
plant    49 MSHQSQISDKYILGRELGRGEFGITYLCTDRET-REALACKSISKRKLRTAVDVEDVRREVTIM- 111

  Fly    84 RFSANHFDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDASHL 148
                         .|...|||:|:|..||||...|:|||||..|||||||||.:|.|||:.|:.:
plant   112 -------------STLPEHPNVVKLKATYEDNENVHLVMELCEGGELFDRIVARGHYTERAAATV 163

  Fly   149 IRQILEAVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLSKMEDSGIMAT-ACGTPGYVA 212
            .|.|.|.|...|..||:||||||||.|:.:..::|.:...|||||.:...|...| ..|:|.|:|
plant   164 ARTIAEVVRMCHVNGVMHRDLKPENFLFANKKENSALKAIDFGLSVLFKPGERFTEIVGSPYYMA 228

  Fly   213 PEVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDSPYWDEISESAKH 277
            |||| ::.||..|||||.|||.||||||.|||:.|.:..:...||:|..:|....|.:||||||.
plant   229 PEVL-KRNYGPEVDVWSAGVILYILLCGVPPFWAETEQGVALAILRGVLDFKRDPWSQISESAKS 292

  Fly   278 FIKNLMCVTVEKRYTCKQALGHAWI-SGNEASSRNIHGTVSEQLKKNFAKSRWKQAYYAATVIRQ 341
            .:|.::.....||.|.:|.|.|.|| :..:|.:..:...|..:||:....:|.|:.  |..||.:
plant   293 LVKQMLEPDSTKRLTAQQVLDHPWIQNAKKAPNVPLGDIVRSRLKQFSMMNRLKKK--ALRVIAE 355

  Fly   342 ---MQRMALNSNSNANFDSSN 359
               :|.:.:..|.....|..|
plant   356 HLSIQEVEVIRNMFTLMDDDN 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 117/276 (42%)
S_TKc 31..302 CDD:214567 115/273 (42%)
CPK30NP_177612.2 STKc_CAMK 58..316 CDD:270687 116/273 (42%)
PTZ00184 353..497 CDD:185504 5/24 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 234 1.000 Inparanoid score I1119
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm971
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X46
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.