DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and CPK19

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_176386.2 Gene:CPK19 / 842490 AraportID:AT1G61950 Length:551 Species:Arabidopsis thaliana


Alignment Length:341 Identity:138/341 - (40%)
Similarity:211/341 - (61%) Gaps:24/341 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IEEKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVK-IIDKKALKGKE-ESLENEIRVLRRFSANH 89
            |:|||:|...||.|.|....:. ::.|.|::||.| |:.:|.::.|: |.:..||:::      |
plant    94 IKEKYSLGRELGRGQFGITYIC-TEISSGKNFACKSILKRKLIRTKDREDVRREIQIM------H 151

  Fly    90 FDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDASHLIRQILE 154
            :    |:|    .||||::...|||:..|:|||||..||||||:|.::|.|:||.|:.:||.:::
plant   152 Y----LSG----QPNIVEIKGAYEDRQSVHLVMELCEGGELFDKITKRGHYSEKAAAEIIRSVVK 208

  Fly   155 AVDYMHEQGVVHRDLKPENLLYYSPDDDSKIM-ISDFGLSK-MEDSGIMATACGTPGYVAPEVLA 217
            .|...|..||:||||||||.|..|.|:.|.:: .:|||:|. :|:..:.....|:..||||||| 
plant   209 VVQICHFMGVIHRDLKPENFLLSSKDEASSMLKATDFGVSVFIEEGKVYEDIVGSAYYVAPEVL- 272

  Fly   218 QKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDSPYWDEISESAKHFIKNL 282
            ::.||||:|:||.|||.||||||.|||:.|.|..:|.:||:|:.:|:|..|..||||||..::|:
plant   273 KRNYGKAIDIWSAGVILYILLCGNPPFWAETDKGIFEEILRGEIDFESEPWPSISESAKDLVRNM 337

  Fly   283 MCVTVEKRYTCKQALGHAWI-SGNEASSRNIHGTVSEQLKKNFAKSRWKQ-AY-YAATVIRQMQR 344
            :....:||:|..|.|.|.|| .|.|||.:.|...|..::|:..|.::.|: |: :.|..:::.:.
plant   338 LKYDPKKRFTAAQVLEHPWIREGGEASDKPIDSAVLSRMKQLRAMNKLKKLAFKFIAQNLKEEEL 402

  Fly   345 MALNSNSNANFDSSNS 360
            ..|.: ..||.|:..|
plant   403 KGLKT-MFANMDTDKS 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 120/277 (43%)
S_TKc 31..302 CDD:214567 117/274 (43%)
CPK19NP_176386.2 STKc_CAMK 97..356 CDD:270687 118/274 (43%)
Pkinase 98..357 CDD:278497 117/274 (43%)
PTZ00184 393..538 CDD:185504 6/26 (23%)
EFh 405..464 CDD:238008 5/14 (36%)
EFh 477..537 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 234 1.000 Inparanoid score I1119
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm971
orthoMCL 1 0.900 - - OOG6_100153
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X46
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.770

Return to query results.
Submit another query.