DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and CDPK2

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_174807.1 Gene:CDPK2 / 840471 AraportID:AT1G35670 Length:495 Species:Arabidopsis thaliana


Alignment Length:325 Identity:129/325 - (39%)
Similarity:186/325 - (57%) Gaps:33/325 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IEEKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKIIDKKALKGKE--ESLENEIRVLRRFSANH 89
            :.:.|.|...||.|.|....|...| |...::|.|.|.|:.|..:|  |.:..||:::...|   
plant    22 LRDHYLLGKKLGQGQFGTTYLCTEK-STSANYACKSIPKRKLVCREDYEDVWREIQIMHHLS--- 82

  Fly    90 FDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDASHLIRQILE 154
                       .|||:|::..||||...|::|||:..|||||||||.||.::|::|..||:.||.
plant    83 -----------EHPNVVRIKGTYEDSVFVHIVMEVCEGGELFDRIVSKGHFSEREAVKLIKTILG 136

  Fly   155 AVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLSKMEDSG-IMATACGTPGYVAPEVLAQ 218
            .|:..|..||:||||||||.|:.||.||:|:..:|||||.....| .:....|:|.||||||| :
plant   137 VVEACHSLGVMHRDLKPENFLFDSPKDDAKLKATDFGLSVFYKPGQYLYDVVGSPYYVAPEVL-K 200

  Fly   219 KPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDSPYWDEISESAKHFIKNLM 283
            |.||..:||||.|||.||||.|.|||:.|.::.:|.|||:|..:|.|..|..|||:||..|..::
plant   201 KCYGPEIDVWSAGVILYILLSGVPPFWAETESGIFRQILQGKLDFKSDPWPTISEAAKDLIYKML 265

  Fly   284 CVTVEKRYTCKQALGHAWISGNEAS-SRNIHGTVSEQLKKNFAKSRWKQAYYAATVIRQMQRMAL 347
            ..:.:||.:..:||.|.||...:|: .:.:...|..:||: |::            :.::::|||
plant   266 ERSPKKRISAHEALCHPWIVDEQAAPDKPLDPAVLSRLKQ-FSQ------------MNKIKKMAL 317

  Fly   348  347
            plant   318  317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 119/276 (43%)
S_TKc 31..302 CDD:214567 119/273 (44%)
CDPK2NP_174807.1 STKc_CAMK 25..283 CDD:270687 119/273 (44%)
Pkinase 26..284 CDD:278497 119/273 (44%)
PTZ00184 320..462 CDD:185504
EFh 332..391 CDD:238008
EFh 404..463 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 234 1.000 Inparanoid score I1119
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm971
orthoMCL 1 0.900 - - OOG6_100153
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X46
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.770

Return to query results.
Submit another query.