DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and CDPK1

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_564066.2 Gene:CDPK1 / 838470 AraportID:AT1G18890 Length:545 Species:Arabidopsis thaliana


Alignment Length:320 Identity:127/320 - (39%)
Similarity:177/320 - (55%) Gaps:20/320 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KDLKELNKQVSIEEKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKIIDKKALKGKE--ESLENE 78
            ||:..::.|..|.:||.|...||.|.|....|...::: .|..|.|.|.|:.|:...  |.:..|
plant    48 KDVIPMSNQTQISDKYILGRELGRGEFGITYLCTDRET-HEALACKSISKRKLRTAVDIEDVRRE 111

  Fly    79 IRVLRRFSANHFDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEK 143
            :.::              .|...|||:|:|..:|||...|:|||||..|||||||||.:|.|||:
plant   112 VAIM--------------STLPEHPNVVKLKASYEDNENVHLVMELCEGGELFDRIVARGHYTER 162

  Fly   144 DASHLIRQILEAVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLSKMEDSGIMAT-ACGT 207
            .|:.:.|.|.|.|...|..||:||||||||.|:.:..::|.:...|||||.....|...| ..|:
plant   163 AAAAVARTIAEVVMMCHSNGVMHRDLKPENFLFANKKENSPLKAIDFGLSVFFKPGDKFTEIVGS 227

  Fly   208 PGYVAPEVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDSPYWDEIS 272
            |.|:||||| ::.||..|||||.|||.||||||.|||:.|.:..:...||:|..:|....|.:||
plant   228 PYYMAPEVL-KRDYGPGVDVWSAGVIIYILLCGVPPFWAETEQGVALAILRGVLDFKRDPWPQIS 291

  Fly   273 ESAKHFIKNLMCVTVEKRYTCKQALGHAWI-SGNEASSRNIHGTVSEQLKKNFAKSRWKQ 331
            ||||..:|.::.....||.|.:|.|.|.|| :..:|.:..:...|..:||:....:|:|:
plant   292 ESAKSLVKQMLDPDPTKRLTAQQVLAHPWIQNAKKAPNVPLGDIVRSRLKQFSMMNRFKK 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 116/276 (42%)
S_TKc 31..302 CDD:214567 114/273 (42%)
CDPK1NP_564066.2 STKc_CAMK 62..320 CDD:270687 115/273 (42%)
FRQ1 360..506 CDD:227455
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 234 1.000 Inparanoid score I1119
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm971
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X46
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.