DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and AT5G24430

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_197831.3 Gene:AT5G24430 / 832514 AraportID:AT5G24430 Length:594 Species:Arabidopsis thaliana


Alignment Length:362 Identity:129/362 - (35%)
Similarity:179/362 - (49%) Gaps:66/362 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FGKKDSGKKAKAKDLKELNKQVSIEEKYNLHGLLGTGAFSEVRLAESKDS--PGEHFAVKIIDKK 66
            |||...||       .||.|:|            |.|.|.....|::|..  ..:..|||||.|.
plant   135 FGKNFEGK-------YELGKEV------------GRGHFGHTCWAKAKKGKMKNQTVAVKIISKA 180

  Fly    67 ALKG--KEESLENEIRVLRRFSANHFDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGE 129
            .:..  ..|.:..|:::|          |.|:|    |.::|:..:.|||...|::||||..|||
plant   181 KMTSTLSIEDVRREVKLL----------KALSG----HRHMVKFYDVYEDADNVFVVMELCEGGE 231

  Fly   130 LFDRIVEKGS-YTEKDASHLIRQILEAVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLS 193
            |.|||:.:|. |.|.||..::.|||.|..:.|.||||||||||||.|:.|.::|:.:.:.|||||
plant   232 LLDRILARGGRYPEVDAKRILVQILSATAFFHLQGVVHRDLKPENFLFTSRNEDAILKVIDFGLS 296

  Fly   194 -------KMEDSGIMATACGTPGYVAPEVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDENDAN 251
                   ::.|      ..|:..||||||| .:.|....|:|||||||||||||..|||...::.
plant   297 DFIRYDQRLND------VVGSAYYVAPEVL-HRSYSTEADMWSIGVISYILLCGSRPFYGRTESA 354

  Fly   252 LFAQILKGDFEFDSPYWDEISESAKHFIKNLMCVTVEKRYTCKQALGHAWISGNEASSRNIHGTV 316
            :|..:|:.:..|:...|..||.:||.|:|.|:.....||.|..|||.|.|:......        
plant   355 IFRCVLRANPNFEDMPWPSISPTAKDFVKRLLNKDHRKRMTAAQALAHPWLRDENPG-------- 411

  Fly   317 SEQLKKNFAKSRWKQAYYAATVIRQMQRMALNSNSNA 353
               |..:|:..:..::|..|:..|   |.||.:.|.|
plant   412 ---LLLDFSVYKLVKSYIRASPFR---RSALKALSKA 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 109/285 (38%)
S_TKc 31..302 CDD:214567 109/282 (39%)
AT5G24430NP_197831.3 STKc_CAMK 142..404 CDD:270687 114/301 (38%)
S_TKc 143..405 CDD:214567 113/294 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 234 1.000 Inparanoid score I1119
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm971
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X46
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.