DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and CPK17

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_196779.1 Gene:CPK17 / 831091 AraportID:AT5G12180 Length:528 Species:Arabidopsis thaliana


Alignment Length:309 Identity:125/309 - (40%)
Similarity:175/309 - (56%) Gaps:20/309 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IEEKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKIIDKKALKGKE--ESLENEIRVLRRFSANH 89
            ::..|:|...||.|.|....|...| :.|..||.|.|.|:.|..||  |.:..|::::     :|
plant    69 VKASYSLGKELGRGQFGVTHLCTQK-ATGHQFACKTIAKRKLVNKEDIEDVRREVQIM-----HH 127

  Fly    90 FDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDASHLIRQILE 154
            ..|:         ||||:|...||||..|:|||||..||||||||:.||.|:|:.|:.|:|.|::
plant   128 LTGQ---------PNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYSERAAASLLRTIVQ 183

  Fly   155 AVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLSKMEDSG-IMATACGTPGYVAPEVLAQ 218
            .|...|..||:||||||||.|..:.|::|.:..:|||||.....| :.....|:..|:|||||.:
plant   184 IVHTCHSMGVIHRDLKPENFLLLNKDENSPLKATDFGLSVFYKPGEVFKDIVGSAYYIAPEVLKR 248

  Fly   219 KPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDSPYWDEISESAKHFIKNLM 283
            | ||...|:|||||:.||||||.|||:.|::..:|..||:|..:|.|..|..||..||..:|.::
plant   249 K-YGPEADIWSIGVMLYILLCGVPPFWAESENGIFNAILRGHVDFSSDPWPSISPQAKDLVKKML 312

  Fly   284 CVTVEKRYTCKQALGHAWI-SGNEASSRNIHGTVSEQLKKNFAKSRWKQ 331
            ....::|.|..|.|.|.|| ...||....:...|..:||:..|.:.:|:
plant   313 NSDPKQRLTAAQVLNHPWIKEDGEAPDVPLDNAVMSRLKQFKAMNNFKK 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 116/276 (42%)
S_TKc 31..302 CDD:214567 116/273 (42%)
CPK17NP_196779.1 STKc_CAMK 73..330 CDD:270687 116/272 (43%)
PTZ00184 371..510 CDD:185504
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 234 1.000 Inparanoid score I1119
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm971
orthoMCL 1 0.900 - - OOG6_100153
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X46
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.770

Return to query results.
Submit another query.