DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and CDPK6

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_194096.1 Gene:CDPK6 / 828465 AraportID:AT4G23650 Length:529 Species:Arabidopsis thaliana


Alignment Length:315 Identity:116/315 - (36%)
Similarity:169/315 - (53%) Gaps:32/315 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IEEKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKIIDKKALKGKE--ESLENEIRVLRRFSANH 89
            :...|.....||.|.|....|...|::. :..|.|.|..:.|..|:  |.:..|::::     :|
plant    74 VRRTYEFGRELGRGQFGVTYLVTHKETK-QQVACKSIPTRRLVHKDDIEDVRREVQIM-----HH 132

  Fly    90 FDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDASHLIRQILE 154
            ..|         |.|||.|...|||:..|.|:|||..||||||||:.||.|:|:.|:.|.||::.
plant   133 LSG---------HRNIVDLKGAYEDRHSVNLIMELCEGGELFDRIISKGLYSERAAADLCRQMVM 188

  Fly   155 AVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLS-------KMEDSGIMATACGTPGYVA 212
            .|...|..||:||||||||.|:.|.|::|.:..:|||||       |.:|      ..|:..|||
plant   189 VVHSCHSMGVMHRDLKPENFLFLSKDENSPLKATDFGLSVFFKPGDKFKD------LVGSAYYVA 247

  Fly   213 PEVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDSPYWDEISESAKH 277
            |||| ::.||...|:||.|||.||||.|.|||:.||:..:|..||:|..:|.:..|..:|:.||.
plant   248 PEVL-KRNYGPEADIWSAGVILYILLSGVPPFWGENETGIFDAILQGQLDFSADPWPALSDGAKD 311

  Fly   278 FIKNLMCVTVEKRYTCKQALGHAWI-SGNEASSRNIHGTVSEQLKKNFAKSRWKQ 331
            .::.::....:.|.|..:.|.|.|| ...|||.:.:...|..::|:..|.::.|:
plant   312 LVRKMLKYDPKDRLTAAEVLNHPWIREDGEASDKPLDNAVLSRMKQFRAMNKLKK 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 107/282 (38%)
S_TKc 31..302 CDD:214567 107/279 (38%)
CDPK6NP_194096.1 STKc_CAMK 78..335 CDD:270687 107/278 (38%)
PTZ00184 372..515 CDD:185504
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 234 1.000 Inparanoid score I1119
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm971
orthoMCL 1 0.900 - - OOG6_100153
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X46
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.770

Return to query results.
Submit another query.