DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and CPK15

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_001190794.1 Gene:CPK15 / 828283 AraportID:AT4G21940 Length:561 Species:Arabidopsis thaliana


Alignment Length:308 Identity:121/308 - (39%)
Similarity:181/308 - (58%) Gaps:19/308 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IEEKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKIIDKKALKGKE--ESLENEIRVLRRFSANH 89
            |.:.|.|...||.|.|. :.....::|.|..:|.|.|.|:.|..|:  :.::.||::::..|...
plant    98 IRKLYTLGKELGRGQFG-ITYTCKENSTGNTYACKSILKRKLTRKQDIDDVKREIQIMQYLSGQE 161

  Fly    90 FDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDASHLIRQILE 154
                          |||::...|||:..::|||||..|.||||||:.:|.|:||.|:.:||.:|.
plant   162 --------------NIVEIKGAYEDRQSIHLVMELCGGSELFDRIIAQGHYSEKAAAGVIRSVLN 212

  Fly   155 AVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLSK-MEDSGIMATACGTPGYVAPEVLAQ 218
            .|...|..||:||||||||.|..|.|:::.:..:|||||. :|:..:.....|:..||||||| :
plant   213 VVQICHFMGVIHRDLKPENFLLASTDENAMLKATDFGLSVFIEEGKVYRDIVGSAYYVAPEVL-R 276

  Fly   219 KPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDSPYWDEISESAKHFIKNLM 283
            :.|||.:|:||.|:|.||||||.|||:.|.:..:|.:|:||:.:|||..|..||||||..::.|:
plant   277 RSYGKEIDIWSAGIILYILLCGVPPFWSETEKGIFNEIIKGEIDFDSQPWPSISESAKDLVRKLL 341

  Fly   284 CVTVEKRYTCKQALGHAWISGNEASSRNIHGTVSEQLKKNFAKSRWKQ 331
            ....::|.:..|||.|.||.|.||..:.|...|..::|:..|.::.|:
plant   342 TKDPKQRISAAQALEHPWIRGGEAPDKPIDSAVLSRMKQFRAMNKLKK 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 111/276 (40%)
S_TKc 31..302 CDD:214567 110/273 (40%)
CPK15NP_001190794.1 S_TKc 102..360 CDD:214567 110/273 (40%)
STKc_CAMK 102..359 CDD:270687 110/272 (40%)
PTZ00184 395..540 CDD:185504
EFh 407..466 CDD:238008
EFh 478..539 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 234 1.000 Inparanoid score I1119
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm971
orthoMCL 1 0.900 - - OOG6_100153
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X46
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.770

Return to query results.
Submit another query.