DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and CPK23

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_001190672.1 Gene:CPK23 / 825809 AraportID:AT4G04740 Length:533 Species:Arabidopsis thaliana


Alignment Length:378 Identity:134/378 - (35%)
Similarity:205/378 - (54%) Gaps:22/378 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IEEKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKIIDKKALKGK--EESLENEIRVLRRFSANH 89
            |.:.|:|...||.|......:.: :...|..:|.|.|.|:.|..:  .|.::.||::::     |
plant    65 IRKFYSLGRELGRGGLGITYMCK-EIGTGNIYACKSILKRKLISELGREDVKTEIQIMQ-----H 123

  Fly    90 FDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDASHLIRQILE 154
            ..|:         ||:|::..:|||:..|:|||||..||||||||:.:|.|:|:.|:..|:.|::
plant   124 LSGQ---------PNVVEIKGSYEDRHSVHLVMELCAGGELFDRIIAQGHYSERAAAGTIKSIVD 179

  Fly   155 AVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLSK-MEDSGIMATACGTPGYVAPEVLAQ 218
            .|...|..||:||||||||.|:.|.::::.:.::|||||. :|:..|.....|:|.|||||||.|
plant   180 VVQICHLNGVIHRDLKPENFLFSSKEENAMLKVTDFGLSAFIEEGKIYKDVVGSPYYVAPEVLRQ 244

  Fly   219 KPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDSPYWDEISESAKHFIKNLM 283
            . |||.:|:||.|||.||||||.|||:.:|:..:|.:|||...:|....|..||:|||..::.::
plant   245 S-YGKEIDIWSAGVILYILLCGVPPFWADNEEGVFVEILKCKIDFVREPWPSISDSAKDLVEKML 308

  Fly   284 CVTVEKRYTCKQALGHAWISGNEASSRNIHGTVSEQLKKNFAKSRWKQ-AYYAATVIRQMQRMAL 347
            ....::|.|..|.|.|.||.|.||..:.|..||..::|:..|.::.|: |...:.|....:.:..
plant   309 TEDPKRRITAAQVLEHPWIKGGEAPEKPIDSTVLSRMKQFRAMNKLKKLALKVSAVSLSEEEIKG 373

  Fly   348 NSNSNANFDSSNSSNQDSTTPTAATGAWTSNVLSSQQSVQSHAQEMNKSGGST 400
            .....||.|::.|..  .|.....||........|:..||...:..:..|..|
plant   374 LKTLFANMDTNRSGT--ITYEQLQTGLSRLRSRLSETEVQQLVEASDVDGNGT 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 109/276 (39%)
S_TKc 31..302 CDD:214567 108/273 (40%)
CPK23NP_001190672.1 STKc_CAMK 82..326 CDD:270687 103/259 (40%)
S_TKc 84..327 CDD:214567 103/258 (40%)
EF-hand_7 374..433 CDD:290234 12/53 (23%)
EFh 374..433 CDD:238008 12/53 (23%)
EFh 445..>492 CDD:238008
EF-hand_7 446..>492 CDD:290234
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 234 1.000 Inparanoid score I1119
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm971
orthoMCL 1 0.900 - - OOG6_100153
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X46
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.770

Return to query results.
Submit another query.