DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and CPK31

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_680596.2 Gene:CPK31 / 825804 AraportID:AT4G04695 Length:484 Species:Arabidopsis thaliana


Alignment Length:321 Identity:121/321 - (37%)
Similarity:174/321 - (54%) Gaps:29/321 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 AKDLKELNKQ------VSIEEKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKIIDKKALKGK-- 71
            :|:||:..:.      |.|.:.|.|...||.|.|...|....|.| |:.:|.|.|.|..||.:  
plant     6 SKNLKQSKRTILEKPFVDIGKVYILGDELGQGQFGITRKCVEKTS-GKTYACKTILKTNLKSRED 69

  Fly    72 EESLENEIRVLRRFSANHFDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRI-- 134
            ||:::.|||:::     |..|:         ||||:..:.|||:..|::|||...|||||.:|  
plant    70 EEAVKREIRIMK-----HLSGE---------PNIVEFKKAYEDRDSVHIVMEYCGGGELFKKIEA 120

  Fly   135 --VEKGSYTEKDASHLIRQILEAVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLSK-ME 196
              .:..||:||:|..:||.|:..|...|..||:.|||||||.|..|.|.::.:...|||.|. :|
plant   121 LSKDGKSYSEKEAVEIIRPIVNVVKNCHYMGVMLRDLKPENFLLSSTDKNATVKAIDFGCSVFIE 185

  Fly   197 DSGIMATACGTPGYVAPEVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDF 261
            :..:.....|:..|:||||| |..|||..|:||.|:|.||||||.|||..|.:|.:|::|.....
plant   186 EGEVHRKFAGSAYYIAPEVL-QGKYGKEADIWSAGIILYILLCGKPPFVTEPEAQMFSEIKSAKI 249

  Fly   262 EFDSPYWDEISESAKHFIKNLMCVTVEKRYTCKQALGHAWISGNEASSRNIHGTVSEQLKK 322
            :.||..|..|...|||.:..::....::|.:..:.|||.|:...|||.:.|.|.|..:||:
plant   250 DVDSESWKFIDVKAKHLVNRMLNRNPKERISAAEVLGHPWMKDGEASDKPIDGVVLSRLKQ 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 108/280 (39%)
S_TKc 31..302 CDD:214567 107/277 (39%)
CPK31NP_680596.2 STKc_CAMK 27..289 CDD:270687 107/277 (39%)
S_TKc 28..290 CDD:214567 107/277 (39%)
PTZ00184 325..470 CDD:185504
EFh 337..396 CDD:238008
EFh 412..469 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 234 1.000 Inparanoid score I1119
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm971
orthoMCL 1 0.900 - - OOG6_100153
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X46
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.