DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and CPK13

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_190753.2 Gene:CPK13 / 824348 AraportID:AT3G51850 Length:528 Species:Arabidopsis thaliana


Alignment Length:349 Identity:130/349 - (37%)
Similarity:193/349 - (55%) Gaps:37/349 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KKDS--GKK-AKAKDLKELNKQVSIEEKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKIIDKKA 67
            :||:  ||| |..:.|.::.|: :||::|.|...||.|.|....|...:.| .:..|.|.|.|:.
plant    27 RKDAAGGKKSAPIRVLSDVPKE-NIEDRYLLDRELGRGEFGVTYLCIERSS-RDLLACKSISKRK 89

  Fly    68 LKGKE--ESLENEIRVLRRFSANHFDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGEL 130
            |:...  |.::.|:.:::....:              .:||.|.|..||.:.|:|||||..||||
plant    90 LRTAVDIEDVKREVAIMKHLPKS--------------SSIVTLKEACEDDNAVHLVMELCEGGEL 140

  Fly   131 FDRIVEKGSYTEKDASHLIRQILEAVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLSKM 195
            |||||.:|.|||:.|:.:.:.|:|.|...|:.||:||||||||.|:.:..::|.:...|||||..
plant   141 FDRIVARGHYTERAAAGVTKTIVEVVQLCHKHGVIHRDLKPENFLFANKKENSPLKAIDFGLSIF 205

  Fly   196 EDSG-IMATACGTPGYVAPEVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKG 259
            ...| ..:...|:|.|:||||| ::.||..:|:||.|||.||||||.|||:.|::..:...||:|
plant   206 FKPGEKFSEIVGSPYYMAPEVL-KRNYGPEIDIWSAGVILYILLCGVPPFWAESEQGVAQAILRG 269

  Fly   260 DFEFDSPYWDEISESAKHFIKNLMCVTVEKRYTCKQALGHAWISGNEASSRNIH-GTVSEQLKKN 323
            ..:|....|..|||:||:.::.::....::|.|.||.|.|.||. |...:.|:. |.|       
plant   270 VIDFKREPWPNISETAKNLVRQMLEPDPKRRLTAKQVLEHPWIQ-NAKKAPNVPLGDV------- 326

  Fly   324 FAKSRWKQAYYAATVIRQMQRMAL 347
             .|||.||    .:|:.:.:|.||
plant   327 -VKSRLKQ----FSVMNRFKRKAL 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 107/276 (39%)
S_TKc 31..302 CDD:214567 105/273 (38%)
CPK13NP_190753.2 STKc_CAMK 53..311 CDD:270687 105/273 (38%)
FRQ1 352..493 CDD:227455
EFh_PEF 470..>526 CDD:355382
EF-hand motif 470..497 CDD:320054
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 234 1.000 Inparanoid score I1119
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm971
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X46
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.