DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and CPK9

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_001327803.1 Gene:CPK9 / 821586 AraportID:AT3G20410 Length:541 Species:Arabidopsis thaliana


Alignment Length:363 Identity:138/363 - (38%)
Similarity:194/363 - (53%) Gaps:45/363 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 KELNKQVSIEEK--------YNLHGLLGTGAFSEVRLAESKDSPGEHFAVKIIDKKAL--KGKEE 73
            |...|..||.|.        |.|...||.|.|....|. :::|.|:.:|.|.|.||.|  |..::
plant    71 KTTTKSNSILENAFEDVKLFYTLGKELGRGQFGVTYLC-TENSTGKKYACKSISKKKLVTKADKD 134

  Fly    74 SLENEIRVLRRFSANHFDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKG 138
            .:..||::::     |..|:         ||||:....|||:..|.|||||..||||||||:.||
plant   135 DMRREIQIMQ-----HLSGQ---------PNIVEFKGAYEDEKAVNLVMELCAGGELFDRIIAKG 185

  Fly   139 SYTEKDASHLIRQILEAVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLSK-MEDSGIMA 202
            .|||:.|:.:.|||:..|...|..||:||||||||.|..|.|:.:.|..:|||||. :|:..:..
plant   186 HYTERAAASVCRQIVNVVKICHFMGVLHRDLKPENFLLSSKDEKALIKATDFGLSVFIEEGKVYR 250

  Fly   203 TACGTPGYVAPEVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDSPY 267
            ...|:..|||||||.:: |||.||:||.|:|.||||.|.|||:.|.:..:|..||:|..:|:|..
plant   251 DIVGSAYYVAPEVLRRR-YGKEVDIWSAGIILYILLSGVPPFWAETEKGIFDAILEGHIDFESQP 314

  Fly   268 WDEISESAKHFIKNLMCVTVEKRYTCKQALGHAWI-SGNEASSRNIHGTVSEQLKKNFAKSRWKQ 331
            |..||.|||..::.::....::|.:....|.|.|: .|.|||.:.|...|..::|:..|.::.|:
plant   315 WPSISSSAKDLVRRMLTADPKRRISAADVLQHPWLREGGEASDKPIDSAVLSRMKQFRAMNKLKK 379

  Fly   332 AYYAATVIRQMQRMALNSNSN---------ANFDSSNS 360
              .|..||      |.|.::.         ||.|:.||
plant   380 --LALKVI------AENIDTEEIQGLKAMFANIDTDNS 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 115/284 (40%)
S_TKc 31..302 CDD:214567 113/273 (41%)
CPK9NP_001327803.1 STKc_CAMK 90..348 CDD:270687 113/273 (41%)
FRQ1 388..528 CDD:227455 6/22 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 234 1.000 Inparanoid score I1119
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm971
orthoMCL 1 0.900 - - OOG6_100153
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X46
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.770

Return to query results.
Submit another query.