DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and AT3G19100

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_188541.1 Gene:AT3G19100 / 821445 AraportID:AT3G19100 Length:599 Species:Arabidopsis thaliana


Alignment Length:345 Identity:128/345 - (37%)
Similarity:182/345 - (52%) Gaps:55/345 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 KELNKQVSIEEKYNLHGLLGTGAF-----SEVRLAESKDSPGEHFAVKIIDKKALKG--KEESLE 76
            |||..::.:.|:      :|.|.|     ::.:..|.||   :..|||:|.|..:..  ..|.:.
plant   138 KELQSRIELGEE------IGRGHFGYTCSAKFKKGELKD---QEVAVKVIPKSKMTSAISIEDVR 193

  Fly    77 NEIRVLRRFSANHFDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEK-GSY 140
            .|:::||..|.              |.|:||..:.:||.:.||:||||..||||.|||:.: |.|
plant   194 REVKILRALSG--------------HQNLVQFYDAFEDNANVYIVMELCGGGELLDRILARGGKY 244

  Fly   141 TEKDASHLIRQILEAVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLS-------KMEDS 198
            :|.||..::.|||..|.:.|.||||||||||||.||.|.:::|.:.:.|||||       ::.| 
plant   245 SEDDAKAVLIQILNVVAFCHLQGVVHRDLKPENFLYTSKEENSMLKVIDFGLSDFVRPDERLND- 308

  Fly   199 GIMATACGTPGYVAPEVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEF 263
                 ..|:..||||||| .:.|....||||||||:||||||..||:...::.:|..:||.|..|
plant   309 -----IVGSAYYVAPEVL-HRSYTTEADVWSIGVIAYILLCGSRPFWARTESGIFRAVLKADPSF 367

  Fly   264 DSPYWDEISESAKHFIKNLMCVTVEKRYTCKQALGHAWISGNEASSRNIHGTVSEQLKKNFAKSR 328
            |.|.|..:|..||.|:|.|:.....||.|..|||.|.||:|.:.........:.:|:|       
plant   368 DEPPWPSLSFEAKDFVKRLLYKDPRKRMTASQALMHPWIAGYKKIDIPFDILIFKQIK------- 425

  Fly   329 WKQAYYAATVIRQMQRMALN 348
               ||..::.:|:...|||:
plant   426 ---AYLRSSSLRKAALMALS 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 114/288 (40%)
S_TKc 31..302 CDD:214567 113/285 (40%)
AT3G19100NP_188541.1 STKc_CAMK 145..405 CDD:270687 114/289 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 234 1.000 Inparanoid score I1119
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm971
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X46
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.