DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and PPCK2

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_566229.1 Gene:PPCK2 / 819609 AraportID:AT3G04530 Length:278 Species:Arabidopsis thaliana


Alignment Length:297 Identity:92/297 - (30%)
Similarity:151/297 - (50%) Gaps:27/297 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LNKQVSIEEKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKIIDKKALKG--KEESLENEIRVLR 83
            :.::..:|..|.|...:|.|.|..:....| .:..|.:|.|.|||:.|..  ..|.:|.|.|::.
plant     1 MTREFELENNYQLCDEIGRGRFGTITRCFS-PATKEFYACKTIDKRVLIDALDRECIETEPRIMA 64

  Fly    84 RFSANHFDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGG-ELFDRIVEKGS-YTEKDAS 146
            ...              .||||:::.:.||.:..:.:|||||... .::||::..|. .:|.:::
plant    65 MLP--------------PHPNIIRIFDLYETEDSLAIVMELVDPPMTIYDRLISAGGRLSESESA 115

  Fly   147 HLIRQILEAVDYMHEQGVVHRDLKPENLLYYSPDD--DSKIMISDFGLSKMEDSGIMATACGTPG 209
            ...:|||.|:.:.|...|||||:||:|:|.    |  ...:.:.|||.:............|||.
plant   116 SYAKQILSALAHCHRCDVVHRDVKPDNVLV----DLVSGGVKLCDFGSAVWLGGETAEGVVGTPY 176

  Fly   210 YVAPEVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDSPYWDEISES 274
            ||||||:..:.|.:.||:||.||:.|.:|.|.|||..|...::|..||:|:..|....:..:|..
plant   177 YVAPEVVMGRKYDEKVDIWSAGVVIYTMLAGEPPFNGETAEDIFESILRGNLRFPPKKFGSVSSE 241

  Fly   275 AKHFIKNLMCVTVEKRYTCKQALGHAWIS--GNEASS 309
            ||..::.::|..|.:|::.:.||.|:|:.  ||..|:
plant   242 AKDLLRKMICRDVSRRFSAEDALRHSWMMNVGNLQSN 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 88/279 (32%)
S_TKc 31..302 CDD:214567 87/276 (32%)
PPCK2NP_566229.1 STKc_CAMK 10..268 CDD:270687 87/276 (32%)
S_TKc 11..269 CDD:214567 87/276 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.