DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and CRK3

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_182193.1 Gene:CRK3 / 819282 AraportID:AT2G46700 Length:595 Species:Arabidopsis thaliana


Alignment Length:333 Identity:117/333 - (35%)
Similarity:166/333 - (49%) Gaps:50/333 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KYNLHGLLGTGAFSEV-----RLAESKDSPGEHFAVKIIDKKALKG--KEESLENEIRVLRRFSA 87
            ||.|...:|.|.|...     :..:.||.|   .|||||.|..:..  ..|.:..|:::|     
plant   142 KYELGKEVGRGHFGHTCSGRGKKGDIKDHP---IAVKIISKAKMTTAIAIEDVRREVKLL----- 198

  Fly    88 NHFDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEK-GSYTEKDASHLIRQ 151
                 |.|:|    |..:::..:..||.:.||:||||..||||.|||:.: |.|.|.||..::.|
plant   199 -----KSLSG----HKYLIKYYDACEDANNVYIVMELCDGGELLDRILARGGKYPEDDAKAIVVQ 254

  Fly   152 ILEAVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLS-------KMEDSGIMATACGTPG 209
            ||..|.:.|.||||||||||||.|:.|..:||.:.:.|||||       ::.|      ..|:..
plant   255 ILTVVSFCHLQGVVHRDLKPENFLFTSSREDSDLKLIDFGLSDFIRPDERLND------IVGSAY 313

  Fly   210 YVAPEVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDSPYWDEISES 274
            ||||||| .:.|....|:||||||:||||||..||:...::.:|..:|:.:..:|...|...|..
plant   314 YVAPEVL-HRSYSLEADIWSIGVITYILLCGSRPFWARTESGIFRTVLRTEPNYDDVPWPSCSSE 377

  Fly   275 AKHFIKNLMCVTVEKRYTCKQALGHAWISGNEASSRNIHGTVSEQLKKNFAKSRWKQAYYAATVI 339
            .|.|:|.|:.....||.:..|||.|.|:..:           |..:..:....:..:||..||.:
plant   378 GKDFVKRLLNKDYRKRMSAVQALTHPWLRDD-----------SRVIPLDILIYKLVKAYLHATPL 431

  Fly   340 RQMQRMAL 347
            |:....||
plant   432 RRAALKAL 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 108/285 (38%)
S_TKc 31..302 CDD:214567 107/285 (38%)
CRK3NP_182193.1 STKc_CAMK 142..404 CDD:270687 108/285 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 234 1.000 Inparanoid score I1119
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm971
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X46
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.