DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and CPK14

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_181717.3 Gene:CPK14 / 818786 AraportID:AT2G41860 Length:530 Species:Arabidopsis thaliana


Alignment Length:401 Identity:147/401 - (36%)
Similarity:211/401 - (52%) Gaps:28/401 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FGKKDSGKKAKAKDLKELNKQVSIEEKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKIIDKKAL 68
            :|....|.|...  |||.... .|::||.|...||.|.|....|....:: ||.||.|.|.||.|
plant    30 YGNHHDGLKLIV--LKEPTGH-EIKQKYKLGRELGRGEFGVTYLCTEIET-GEIFACKSILKKKL 90

  Fly    69 KGK--EESLENEIRVLRRFSANHFDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGELF 131
            |..  .|.::.|:.::|:..              .|||||.|.|||||...|:|||||..|||||
plant    91 KTSIDIEDVKREVEIMRQMP--------------EHPNIVTLKETYEDDKAVHLVMELCEGGELF 141

  Fly   132 DRIVEKGSYTEKDASHLIRQILEAVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLSKME 196
            ||||.:|.|||:.|:.:|:.|:|.|...|:.||:||||||||.|:.:..:.:.:...|||||...
plant   142 DRIVARGHYTERAAASVIKTIIEVVQMCHKHGVMHRDLKPENFLFANKKETASLKAIDFGLSVFF 206

  Fly   197 DSG-IMATACGTPGYVAPEVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGD 260
            ..| ......|:|.|:||||| ::.||:.:|:||.|||.||||||.|||:.|.:..:...|||..
plant   207 KPGERFNEIVGSPYYMAPEVL-RRSYGQEIDIWSAGVILYILLCGVPPFWAETEHGVAKAILKSV 270

  Fly   261 FEFDSPYWDEISESAKHFIKNLMCVTVEKRYTCKQALGHAWI-SGNEASSRNIHGTVSEQLKKNF 324
            .:|....|.::|::||..||.::.....:|.|.:|.|.|.|| :|..||:.::..||..:||:..
plant   271 IDFKRDPWPKVSDNAKDLIKKMLHPDPRRRLTAQQVLDHPWIQNGKNASNVSLGETVRARLKQFS 335

  Fly   325 AKSRWKQAYYAATVIRQMQRMALNSNSNANFDSSNSSNQDSTTPT-AATGAWTSNVLSSQQSVQ- 387
            ..::.|:.  |..||.:...:...|.....|...::||:...|.| ...|.....::..|..:| 
plant   336 VMNKLKKR--ALRVIAEHLSVEETSCIKERFQVMDTSNRGKITITELGIGLQKLGIVVPQDDIQI 398

  Fly   388 -SHAQEMNKSG 397
             ..|.:::|.|
plant   399 LMDAGDVDKDG 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 116/276 (42%)
S_TKc 31..302 CDD:214567 114/273 (42%)
CPK14NP_181717.3 STKc_CAMK 53..311 CDD:270687 115/273 (42%)
FRQ1 351..493 CDD:227455 12/59 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 234 1.000 Inparanoid score I1119
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm971
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X46
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.