DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and CRK1

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_181647.1 Gene:CRK1 / 818713 AraportID:AT2G41140 Length:576 Species:Arabidopsis thaliana


Alignment Length:331 Identity:121/331 - (36%)
Similarity:170/331 - (51%) Gaps:47/331 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 YNLHGLLGTGAFSEVRLAESKDS--PGEHFAVKIIDKKALKG--KEESLENEIRVLRRFSANHFD 91
            |.:.|.:|.|.|.....|:.|..  .|:..|||:|.|..:..  ..|.:..|:::||        
plant   123 YEIDGEVGRGHFGYTCSAKGKKGSLKGQEVAVKVIPKSKMTTAIAIEDVSREVKMLR-------- 179

  Fly    92 GKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEK-GSYTEKDASHLIRQILEA 155
              .|.|    |.|:||..:.:||...||:||||..||||.|:|::: |.|:|.||..::.|||..
plant   180 --ALTG----HKNLVQFYDAFEDDENVYIVMELCKGGELLDKILQRGGKYSEDDAKKVMVQILSV 238

  Fly   156 VDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLS-------KMEDSGIMATACGTPGYVAP 213
            |.|.|.||||||||||||.|:.:.|:.|.:...|||||       ::.|      ..|:..||||
plant   239 VAYCHLQGVVHRDLKPENFLFSTKDETSPLKAIDFGLSDYVKPDERLND------IVGSAYYVAP 297

  Fly   214 EVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDSPYWDEISESAKHF 278
            ||| .:.||...|:||||||:||||||..||:...::.:|..:||.:..|:...|..:|..|..|
plant   298 EVL-HRTYGTEADMWSIGVIAYILLCGSRPFWARTESGIFRAVLKAEPNFEEAPWPSLSPEAVDF 361

  Fly   279 IKNLMCVTVEKRYTCKQALGHAWISGNEASSRNIHGTVSEQLK--KNFAKSRWKQAYYAATVIRQ 341
            :|.|:.....||.|..|||.|.|:.|            |.:||  .:....:..:.|..:|.:|:
plant   362 VKRLLNKDYRKRLTAAQALCHPWLVG------------SHELKIPSDMIIYKLVKVYIMSTSLRK 414

  Fly   342 MQRMAL 347
            ....||
plant   415 SALAAL 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 111/281 (40%)
S_TKc 31..302 CDD:214567 111/282 (39%)
CRK1NP_181647.1 STKc_CAMK 122..384 CDD:270687 111/281 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 234 1.000 Inparanoid score I1119
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm971
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X46
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.