DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and CPK25

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_001318361.1 Gene:CPK25 / 818162 AraportID:AT2G35890 Length:520 Species:Arabidopsis thaliana


Alignment Length:356 Identity:131/356 - (36%)
Similarity:190/356 - (53%) Gaps:47/356 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SGKKAKAKDLKEL------------NKQVSIEEKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVK 61
            :..|.||.:::.|            .|...::|.|||...||.|.|....:...|.: ||.:|.|
plant    98 ANSKRKAHNVRRLMSAGLQAESVLKTKTGHLKEYYNLGSKLGHGQFGTTFVCVEKGT-GEEYACK 161

  Fly    62 IIDKKALKGKE--ESLENEIRVLRRFSANHFDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMEL 124
            .|.|:.|:.:|  |.:..||.:::..              |..||::.:...|||...|::||||
plant   162 SIPKRKLENEEDVEDVRREIEIMKHL--------------LGQPNVISIKGAYEDSVAVHMVMEL 212

  Fly   125 VTGGELFDRIVEKGSYTEKDASHLIRQILEAVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISD 189
            ..||||||||||:|.|:|:.|:||.:.||..|...|..||:||||||||.|:.:.|:||.:...|
plant   213 CRGGELFDRIVERGHYSERKAAHLAKVILGVVQTCHSLGVMHRDLKPENFLFVNDDEDSPLKAID 277

  Fly   190 FGLSKMEDSGIMAT-ACGTPGYVAPEVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLF 253
            ||||.....|...| ..|:|.|:||||| .|.||...|:||.||:.|:||.|..||:.|.:..:|
plant   278 FGLSMFLKPGENFTDVVGSPYYIAPEVL-NKNYGPEADIWSAGVMIYVLLSGSAPFWGETEEEIF 341

  Fly   254 AQILKGDFEFDSPYWDEISESAKHFIKNLMCVTVEKRYTCKQALGHAWI--SGNEASSRNIHGTV 316
            .::|:|:.:..|..|.::|||||..|:.::.....:|.|.:|.|.|.||  .|| |....:..||
plant   342 NEVLEGELDLTSDPWPQVSESAKDLIRKMLERNPIQRLTAQQVLCHPWIRDEGN-APDTPLDTTV 405

  Fly   317 SEQLKKNFAKSRWKQAYYAATVIRQMQRMAL 347
            ..:|||           ::||  .::::|||
plant   406 LSRLKK-----------FSAT--DKLKKMAL 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 111/276 (40%)
S_TKc 31..302 CDD:214567 110/273 (40%)
CPK25NP_001318361.1 STKc_CAMK 132..389 CDD:270687 110/272 (40%)
FRQ1 429..>509 CDD:227455
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 234 1.000 Inparanoid score I1119
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm971
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X46
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.