DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and CPK24

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_180708.1 Gene:CPK24 / 817708 AraportID:AT2G31500 Length:582 Species:Arabidopsis thaliana


Alignment Length:351 Identity:126/351 - (35%)
Similarity:186/351 - (52%) Gaps:43/351 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IEEKYNLHGLLGTGAFS------EVRLAESKDSPGEHFAVKIIDKKALKGK--EESLENEIRVLR 83
            |..||:|...||.|.|.      |:       |..|.||.|.|.|:.|:.:  .|.:..|:.::|
plant    62 IHLKYDLGKELGRGEFGVTHECIEI-------STRERFACKRISKEKLRTEIDVEDVRREVEIMR 119

  Fly    84 RFSANHFDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDASHL 148
                      ||.    .|||||...|.:|||..||||||:..|||||||||.:|.|||:.|:.:
plant   120 ----------CLP----KHPNIVSFKEAFEDKDAVYLVMEICEGGELFDRIVSRGHYTERAAASV 170

  Fly   149 IRQILEAVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLS-KMEDSGIMATACGTPGYVA 212
            .:.|||.|...||.||:||||||||.|:.:..:.:::...||||| ..:.:.......|:|.|:|
plant   171 AKTILEVVKVCHEHGVIHRDLKPENFLFSNGTETAQLKAIDFGLSIFFKPAQRFNEIVGSPYYMA 235

  Fly   213 PEVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDSPYWDEISESAKH 277
            |||| ::.||..:||||.|||.||||||.|||:.|.:..:...|::|:.:|:...|.::|..||.
plant   236 PEVL-RRNYGPEIDVWSAGVILYILLCGVPPFWAETEEGIAHAIVRGNIDFERDPWPKVSHEAKE 299

  Fly   278 FIKNLMCVTVEKRYTCKQALGHAWISGNE-ASSRNIHGTVSEQLKKNFAKSRWKQAYY------- 334
            .:||::......|.|.::.|.|.||...| |.:.|:...|..::::....:|:|:...       
plant   300 LVKNMLDANPYSRLTVQEVLEHPWIRNAERAPNVNLGDNVRTKIQQFLLMNRFKKKVLRIVADNL 364

  Fly   335 ----AATVIRQMQRMALNSNSNANFD 356
                .|.:::..|.|..:.|.:..|:
plant   365 PNEEIAAIVQMFQTMDTDKNGHLTFE 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 113/282 (40%)
S_TKc 31..302 CDD:214567 111/279 (40%)
CPK24NP_180708.1 STKc_CAMK 65..323 CDD:270687 112/279 (40%)
FRQ1 363..512 CDD:227455 5/28 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 234 1.000 Inparanoid score I1119
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm971
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X46
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.