DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaMKI and CAMK4

DIOPT Version :9

Sequence 1:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_001310303.1 Gene:CAMK4 / 814 HGNCID:1464 Length:473 Species:Homo sapiens


Alignment Length:346 Identity:146/346 - (42%)
Similarity:217/346 - (62%) Gaps:35/346 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SIEEKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKI----IDKKALKGKEESLENEIRVLRRFS 86
            ::.:.:.:...||.||.|.|...:.|.:. :.:|:|:    :|||.::       .||.||    
Human    41 ALSDFFEVESELGRGATSIVYRCKQKGTQ-KPYALKVLKKTVDKKIVR-------TEIGVL---- 93

  Fly    87 ANHFDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDASHLIRQ 151
                       .||:||||::|.|.:|..:::.||:||||||||||||||||.|:|:||:..::|
Human    94 -----------LRLSHPNIIKLKEIFETPTEISLVLELVTGGELFDRIVEKGYYSERDAADAVKQ 147

  Fly   152 ILEAVDYMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLSK-MEDSGIMATACGTPGYVAPEV 215
            |||||.|:||.|:||||||||||||.:|..|:.:.|:|||||| :|...:|.|.||||||.|||:
Human   148 ILEAVAYLHENGIVHRDLKPENLLYATPAPDAPLKIADFGLSKIVEHQVLMKTVCGTPGYCAPEI 212

  Fly   216 LAQKPYGKAVDVWSIGVISYILLCGYPPFYDE-NDANLFAQILKGDFEFDSPYWDEISESAKHFI 279
            |....||..||:||:|:|:||||||:.||||| .|..:|.:||..::.|.||:|||:|.:||..:
Human   213 LRGCAYGPEVDMWSVGIITYILLCGFEPFYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDLV 277

  Fly   280 KNLMCVTVEKRYTCKQALGHAWISGNEASSRNIH-GTVSEQLKKNFAKSRWKQAYYAATVIRQMQ 343
            :.|:.:..:||.|..|||.|.|::|..|:.  :| .|..::|::..|:.:.|.|..|...   ..
Human   278 RKLIVLDPKKRLTTFQALQHPWVTGKAANF--VHMDTAQKKLQEFNARRKLKAAVKAVVA---SS 337

  Fly   344 RMALNSNSNANFDSSNSSNQD 364
            |:...|:|:.:...|:.:::|
Human   338 RLGSASSSHGSIQESHKASRD 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 131/279 (47%)
S_TKc 31..302 CDD:214567 131/276 (47%)
CAMK4NP_001310303.1 STKc_CaMKIV 42..335 CDD:270987 141/317 (44%)
Pkinase 46..300 CDD:278497 131/276 (47%)
Autoinhibitory domain 305..321 4/17 (24%)
PP2A-binding 306..323 3/18 (17%)
Calmodulin-binding. /evidence=ECO:0000255 322..341 5/21 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 341..368 4/18 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 445..473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 1 1.000 - - FOG0000163
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100153
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X46
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.